Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0118
Type: CDS
Description: identified by Glimmer2; putative
Source: Genbank
Position: CP000031.2:126237..127478 (+ strand)
Length: 1242
Dbxref: NCBI_GP:AAV93447.1
IMG:
Note: identified by Glimmer2; putative
RefSeq: SPO_RS00600: hypothetical protein
gbkey: CDS
gene: SPO0118
load_id: cds-AAV93447.1
locus_tag: SPO0118
parent_id: gene-SPO0118
product: hypothetical protein
protein_id: AAV93447.1
transl_table: 11
translation: MSQKYQLQTLARFSSLVLVSSYFRGRRLAMKTLLTTLFSLSALAAALSIVALFTAEAQIS DYGVAAFFFAMTIALYLLARWYLIRFGRIGLLKPKLFRREPRGNALKAQTTISSAGWITD SLSAVMRKRNGVDLDIHTLVRLEIAKIKEVGLHGKARTFEEILTETLLLRFVETDNRDRS KPPISILRQVRDTKDFWRLREMVDEHYAKSAAKGAAYRAWEDAVGDVDQSHLLKDGWIPF LKSLPGPDINLWHGVATDFHEISEDRLDAAFWIVEQDACDRTTASEFIMGFLQARMDIGI YDPDGTRGRLPPDPRLERFVGVINLYNDGFYKFHSLNAGVFSAVNLEDQVANDLLTNNEK YTGLSGLPRPRKIVKEGEKPVHSGPRGYDSPYAYWDEAGLHLKYPGDDWQKTG
>SPO0118 class=Sequence position=CP000031.2:126237..127478 (+ strand)
GTGTCGCAGA AATATCAGCT GCAAACTCTC GCGCGATTTT CGTCGTTGGT CCTAGTTTCG TCCTATTTCC GCGGTAGGCG
ATTGGCCATG AAAACACTGC TGACTACCCT GTTCTCACTG TCTGCGCTCG CCGCTGCGCT ATCGATCGTG GCACTATTTA
CAGCCGAGGC GCAGATCTCG GACTATGGTG TTGCCGCCTT CTTTTTCGCC ATGACCATTG CGTTGTATCT GCTCGCGAGA
TGGTACCTGA TCAGGTTTGG GCGCATTGGC CTGTTGAAGC CTAAACTGTT CAGAAGAGAG CCACGCGGCA ATGCCCTCAA
GGCTCAAACG ACAATTTCAT CCGCCGGTTG GATCACCGAC AGCCTGAGCG CGGTGATGCG AAAGCGGAAT GGGGTGGACC
TTGATATTCA CACTTTGGTC CGGCTGGAGA TCGCTAAAAT AAAAGAGGTC GGTCTTCACG GCAAAGCGCG TACATTTGAG
GAGATTTTGA CGGAGACGCT ATTGCTTCGA TTTGTTGAAA CCGACAACAG AGATCGCAGC AAACCGCCAA TATCGATCCT
GCGACAGGTC AGGGATACCA AGGACTTTTG GCGCCTGCGC GAAATGGTGG ATGAGCACTA TGCAAAGAGC GCGGCGAAAG
GCGCAGCCTA CCGCGCTTGG GAGGATGCAG TGGGCGATGT CGATCAGAGC CACCTGCTCA AGGATGGCTG GATCCCGTTC
CTCAAGTCGC TTCCCGGACC CGACATCAAC CTCTGGCACG GGGTCGCGAC CGATTTCCAT GAAATCTCAG AAGATCGCTT
GGACGCTGCA TTTTGGATCG TCGAGCAAGA CGCATGTGAC CGCACAACCG CGTCAGAGTT CATCATGGGG TTTCTTCAGG
CGCGGATGGA CATCGGCATC TACGATCCCG ACGGCACTAG AGGTCGTTTG CCGCCCGATC CACGCCTGGA GCGTTTTGTG
GGTGTCATCA ATCTGTACAA TGACGGCTTC TACAAGTTTC ATTCTCTAAA CGCGGGTGTT TTTTCCGCGG TAAACTTGGA
AGATCAGGTC GCAAATGACC TGCTGACCAA TAACGAAAAG TACACCGGGC TTAGCGGCCT GCCGCGCCCT CGCAAGATCG
TCAAAGAGGG TGAAAAACCG GTTCATTCGG GGCCTCGGGG CTACGATTCT CCGTATGCCT ATTGGGATGA AGCCGGTCTA
CACTTGAAGT ACCCCGGGGA CGATTGGCAA AAGACGGGTT AA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7