Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0119
Type: CDS
Description: identified by match to protein family HMM PF01037
Source: Genbank
Position: CP000031.2:127691..128194 (- strand)
Length: 504
"ID: cds-AAV93448.1
Dbxref: NCBI_GP:AAV93448.1
IMG: SPO0119: transcriptional regulator
  AsnC family
Note: identified by match to protein family HMM PF01037
RefSeq: SPO_RS00605: Lrp/AsnC family transcriptional regulator"
gbkey: CDS
gene: SPO0119
locus_tag: SPO0119
parent_id: gene-SPO0119
product: transcriptional regulator
  AsnC family
protein_id: AAV93448.1
transl_table: 11
translation: MYVAQSNSRKKEKEPSNLRSKESVLDSIDAAILRELCADARIPRAELSRRVGLSAPSVGD RVRRLEDIGIITGYGARIDPARLGYGLTILIRARPLPGEMANMIEAIQDTPQIVACDRVS GEDCFVARAHVRDVAEMEAVIDRIVPFGATNSSIVQSSPVEERLVEL
>SPO0119 class=Sequence position=CP000031.2:127691..128194 (- strand)
ATGTATGTGG CGCAATCAAA CTCCCGAAAG AAGGAAAAAG AACCCTCAAA CCTTCGATCC AAAGAAAGCG TTCTCGACAG
CATCGATGCG GCGATTCTGC GCGAACTCTG TGCTGACGCC CGTATTCCAC GCGCGGAACT GTCCCGCCGC GTCGGCCTCT
CTGCCCCGAG TGTGGGAGAC CGTGTGCGGC GTCTCGAAGA TATCGGTATC ATCACCGGAT ACGGGGCGCG CATCGACCCC
GCGCGTCTCG GCTATGGTTT GACGATCTTG ATCCGTGCCC GCCCTTTGCC GGGTGAAATG GCAAATATGA TCGAAGCCAT
TCAGGACACG CCTCAAATTG TCGCTTGCGA CCGTGTGTCA GGTGAAGACT GCTTCGTCGC GCGTGCGCAC GTCCGTGACG
TCGCGGAAAT GGAAGCGGTC ATCGACCGGA TCGTGCCCTT CGGCGCGACG AACTCTTCAA TCGTGCAATC GTCACCTGTA
GAAGAGCGAT TGGTTGAACT CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7