Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0120
Type: gene
Description:
Source: Genbank
Position: CP000031.2:128242..129201 (+ strand)
Length: 960
gbkey: Gene
gene: SPO0120
gene_biotype: protein_coding
load_id: gene-SPO0120
locus_tag: SPO0120
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00892
Source: Genbank
Position: CP000031.2:128242..129201 (+ strand)
Length: 960
Dbxref: NCBI_GP:AAV93449.1
IMG: SPO0120: inner membrane transporter RhtA
Note: identified by match to protein family HMM PF00892
RefSeq: SPO_RS00610: EamA family transporter
gbkey: CDS
gene: SPO0120
load_id: cds-AAV93449.1
locus_tag: SPO0120
parent_id: gene-SPO0120
product: hypothetical protein
protein_id: AAV93449.1
transl_table: 11
translation: MSNQARTNSASAPGTMSRMSEAVPPHAWFGVSAVFHYLGPAFAVLLFPVVGVLGVAWFRI ASAALIFAPITKPWRTFKTSTPRERLLLLALGGCLAVMNSSFYLALDRLPISLVAAIEFM GTIGIALWGLRTGRNYLAFALAIIGVALLIDVASLRAMDGPDPTSDLLGLFWALLNGSLF VLYIILGHKISEGGASGGVERLGAAMTAAFIFVMPLGFLQALEAFGAPLLVLAGIGVGIC SSVIPYVCDQLAMARLPRASFAFLLALLPATATIIGAVVLRQIPSAMDVLGVALVMIGVA VHKPAPMASRAAAEMGSAS
>SPO0120 class=Sequence position=CP000031.2:128242..129201 (+ strand)
ATGTCTAATC AAGCCCGCAC AAACTCTGCC AGCGCCCCCG GAACCATGTC CCGCATGTCA GAGGCCGTTC CTCCACACGC
ATGGTTCGGC GTCTCAGCCG TTTTCCACTA TCTCGGCCCC GCTTTCGCGG TGTTGTTGTT TCCGGTGGTT GGTGTGCTTG
GTGTCGCCTG GTTTCGTATC GCCTCGGCCG CCTTGATCTT CGCCCCGATC ACGAAGCCCT GGCGGACCTT CAAGACATCG
ACGCCTCGTG AGCGTCTTCT TCTGCTGGCG CTTGGTGGTT GCCTCGCCGT GATGAACAGC TCTTTCTATC TGGCGCTCGA
CCGCCTGCCG ATCTCTCTGG TCGCCGCCAT CGAGTTCATG GGCACCATCG GTATCGCTCT TTGGGGTCTG CGCACGGGCC
GCAACTATCT GGCTTTCGCC CTTGCCATCA TTGGAGTGGC GCTCCTGATC GACGTAGCCT CACTTCGGGC TATGGACGGG
CCGGACCCCA CGTCTGACCT TCTCGGACTG TTCTGGGCGT TGCTGAACGG CTCGCTATTC GTCCTCTACA TCATCCTCGG
CCACAAGATT TCGGAAGGTG GCGCTTCGGG CGGTGTGGAG CGGCTAGGCG CTGCCATGAC AGCGGCTTTC ATCTTCGTGA
TGCCCCTCGG GTTCCTGCAA GCCCTCGAAG CGTTTGGTGC GCCCTTGCTG GTGCTGGCCG GGATCGGTGT CGGTATCTGT
TCCTCGGTCA TCCCGTATGT CTGCGACCAG CTCGCCATGG CCCGCTTGCC ACGCGCCAGC TTCGCATTCC TGCTCGCTCT
CTTGCCTGCG ACCGCCACGA TCATCGGCGC AGTCGTCCTG CGTCAAATTC CGAGCGCGAT GGACGTCCTG GGCGTCGCCC
TTGTCATGAT CGGCGTGGCC GTTCACAAAC CCGCGCCGAT GGCTTCGCGT GCGGCGGCGG AGATGGGTTC GGCGTCGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7