Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0122
Type: gene
Description:
Source: Genbank
Position: CP000031.2:130161..130448 (- strand)
Length: 288
gbkey: Gene
gene: SPO0122
gene_biotype: protein_coding
load_id: gene-SPO0122
locus_tag: SPO0122
Parts:
Type: CDS
Description: identified by match to protein family HMM PF02325
Source: Genbank
Position: CP000031.2:130161..130448 (- strand)
Length: 288
Dbxref: NCBI_GP:AAV93450.1
IMG:
Note: identified by match to protein family HMM PF02325
RefSeq: SPO_RS00625: MULTISPECIES: YggT family protein
gbkey: CDS
gene: SPO0122
load_id: cds-AAV93450.1
locus_tag: SPO0122
parent_id: gene-SPO0122
product: YGGT family protein
protein_id: AAV93450.1
transl_table: 11
translation: MQSLFQILMLILDVIWFFILAHVIMSWLINFQVLNMRQQLVAQIWYGLNRVLEPIYGPIR RILPPMGGLDLTPLVVLLAIMALRIVLINNAALFY
>SPO0122 class=Sequence position=CP000031.2:130161..130448 (- strand)
ATGCAGTCGC TGTTTCAAAT CCTGATGCTG ATCCTGGATG TGATCTGGTT CTTCATCCTG GCCCATGTGA TCATGAGCTG
GCTGATCAAC TTTCAGGTCC TGAACATGCG CCAGCAGCTG GTGGCGCAGA TCTGGTACGG GCTGAACCGG GTGCTGGAGC
CGATCTATGG CCCAATCCGC CGGATATTGC CGCCGATGGG CGGGCTCGAC CTGACCCCGC TGGTGGTGCT GCTGGCGATC
ATGGCGCTGC GCATCGTGCT GATCAACAAC GCGGCACTGT TCTATTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7