Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0123
Type: gene
Description:
Source: Genbank
Position: CP000031.2:130602..131966 (+ strand)
Length: 1365
gbkey: Gene
gene: SPO0123
gene_biotype: protein_coding
load_id: gene-SPO0123
locus_tag: SPO0123
Parts:
Type: CDS
Description: identified by match to protein family HMM PF07690
Source: Genbank
Position: CP000031.2:130602..131966 (+ strand)
Length: 1365
"ID: cds-AAV93451.1
Dbxref: NCBI_GP:AAV93451.1
IMG: SPO0123: MFS transporter
  UMF1 family
Note: identified by match to protein family HMM PF07690
RefSeq: SPO_RS00630: MFS transporter"
gbkey: CDS
gene: SPO0123
locus_tag: SPO0123
parent_id: gene-SPO0123
product: hypothetical protein
protein_id: AAV93451.1
transl_table: 11
translation: MADISARKRIWGWYFFDWASQPYHTLLVTFVFSPFFAAVAADYFLGQGMADEAAKAQAQV VWSQCLTITGLIIGFGAPFLGAMADISGRRMTWITLFCGMYVVGAWGLWYMDPTGGNLWW MMASFGIGFIGAEYALIFINAQLPSLGTKEEVGQISGSGFAFGYLGGVVALFIMLLLFVE QGNGKTLVGLDPVLGLDPDTREGTRAVGPFTALWFVIFMIPYFLWVREPAGSGRRGSFAE AVAMVVQSVKNLRHRGSLASYLASSMFYRDALNGLYGFGGVYARLVLGWEITMIGVFGII AAISAAAFSWLGGLADRRVGPKPVIVGSILVLILVCATIVGMDRTQIFGIPLAEGSGLPD FVFFFCGVLIGGFGGIVQAASRSLMVRHTDPEMPTESFGLYGLSGRATAFLAPALIGAAT AATGSARLGVSPVVGLFILGLILLIWVKPQGDQK
>SPO0123 class=Sequence position=CP000031.2:130602..131966 (+ strand)
ATGGCGGATA TCTCGGCGCG CAAGCGTATC TGGGGCTGGT ATTTCTTCGA CTGGGCCAGC CAACCCTATC ACACCCTGCT
TGTGACCTTT GTGTTCAGCC CGTTCTTTGC CGCGGTGGCG GCGGATTACT TCCTGGGTCA GGGGATGGCG GACGAGGCCG
CCAAGGCGCA GGCCCAGGTG GTCTGGTCGC AATGTCTGAC CATCACCGGG CTGATCATCG GTTTCGGCGC ACCCTTTCTG
GGGGCAATGG CCGATATCTC GGGCCGGCGC ATGACCTGGA TCACGCTGTT CTGCGGCATG TATGTCGTCG GTGCCTGGGG
CCTGTGGTAC ATGGATCCGA CTGGTGGCAA CCTGTGGTGG ATGATGGCCA GTTTCGGCAT CGGTTTCATC GGTGCAGAAT
ATGCGCTGAT CTTCATCAAT GCACAGCTCC CCTCGCTAGG CACCAAGGAG GAGGTGGGCC AGATCTCGGG ATCGGGGTTT
GCCTTTGGGT ATCTCGGCGG GGTGGTGGCG CTGTTCATCA TGCTGCTGCT CTTTGTCGAG CAGGGCAATG GCAAGACGCT
GGTCGGGCTC GACCCGGTAT TGGGTCTTGA TCCGGATACC CGCGAGGGGA CACGCGCCGT TGGCCCGTTC ACCGCGCTCT
GGTTCGTGAT CTTCATGATC CCCTATTTCC TGTGGGTGCG CGAACCCGCC GGCAGCGGAC GGCGCGGCAG TTTTGCCGAA
GCGGTTGCGA TGGTGGTGCA ATCGGTCAAG AACCTGCGCC ACCGAGGCAG CCTGGCCAGC TATCTGGCGT CGTCGATGTT
TTATCGCGAT GCGCTCAACG GGCTTTACGG CTTTGGCGGG GTCTATGCCC GGCTGGTGCT GGGCTGGGAG ATCACGATGA
TCGGCGTGTT CGGCATCATC GCGGCGATCT CGGCGGCGGC GTTCAGCTGG CTGGGCGGGC TGGCGGATCG CAGGGTGGGG
CCAAAACCGG TCATCGTCGG CTCGATCCTG GTGCTGATCC TGGTCTGCGC CACCATTGTG GGCATGGACC GGACCCAGAT
ATTCGGCATC CCGCTGGCCG AGGGCTCGGG CCTGCCCGAT TTCGTCTTCT TCTTCTGCGG CGTGTTGATC GGCGGGTTCG
GCGGTATCGT GCAGGCGGCC AGCCGGTCGT TGATGGTGCG CCATACCGAT CCCGAAATGC CCACCGAAAG CTTTGGTCTT
TACGGCCTGT CCGGCCGGGC CACCGCCTTT CTGGCGCCTG CCCTGATCGG CGCCGCGACA GCGGCGACAG GCTCGGCGCG
CTTGGGGGTT TCGCCGGTCG TCGGCTTGTT TATTCTGGGC TTGATCCTGT TGATTTGGGT GAAACCGCAA GGGGACCAGA
AATAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7