Parts: | Type: | CDS | Description: | identified by similarity to GB:AAM35138.1; match to protein family HMM PF00472 | Source: | Genbank | Position: | CP000031.2:134704..135123 (+ strand) | Length: | 420 | Dbxref: | NCBI_GP:AAV93455.1 | IMG: | | Note: | identified by similarity to GB:AAM35138.1; match to protein family HMM PF00472 | RefSeq: | SPO_RS00650: arfB: aminoacyl-tRNA hydrolase
| gbkey: | CDS | gene: | SPO0127 | load_id: | cds-AAV93455.1 | locus_tag: | SPO0127 | parent_id: | gene-SPO0127 | product: | peptidyl-tRNA hydrolase domain protein | protein_id: | AAV93455.1 | transl_table: | 11 | translation: | MLYVTDDIAIQDWELSESFMRASGPGGQNVNKVSSAVELRFEAARSPSLPAPVKARLKRL AGRRWTGEGAIVLQCDETRSQARNREIVRARLVELIARALVAPKRRIATKPTRGSVRRRL DSKKARGEVKALRGKIGDE |
---|
| |
---|
|
---|