Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0127
Type: gene
Description:
Source: Genbank
Position: CP000031.2:134704..135123 (+ strand)
Length: 420
gbkey: Gene
gene: SPO0127
gene_biotype: protein_coding
load_id: gene-SPO0127
locus_tag: SPO0127
Parts:
Type: CDS
Description: identified by similarity to GB:AAM35138.1; match to protein family HMM PF00472
Source: Genbank
Position: CP000031.2:134704..135123 (+ strand)
Length: 420
Dbxref: NCBI_GP:AAV93455.1
IMG:
Note: identified by similarity to GB:AAM35138.1; match to protein family HMM PF00472
RefSeq: SPO_RS00650: arfB: aminoacyl-tRNA hydrolase
gbkey: CDS
gene: SPO0127
load_id: cds-AAV93455.1
locus_tag: SPO0127
parent_id: gene-SPO0127
product: peptidyl-tRNA hydrolase domain protein
protein_id: AAV93455.1
transl_table: 11
translation: MLYVTDDIAIQDWELSESFMRASGPGGQNVNKVSSAVELRFEAARSPSLPAPVKARLKRL AGRRWTGEGAIVLQCDETRSQARNREIVRARLVELIARALVAPKRRIATKPTRGSVRRRL DSKKARGEVKALRGKIGDE
>SPO0127 class=Sequence position=CP000031.2:134704..135123 (+ strand)
ATGCTGTATG TGACCGACGA TATCGCGATC CAGGATTGGG AGCTGAGCGA AAGCTTCATG CGCGCCTCGG GGCCGGGCGG
GCAGAATGTG AACAAGGTGT CCTCGGCCGT CGAATTGCGG TTCGAGGCGG CGCGCTCGCC CTCCTTGCCC GCTCCGGTCA
AGGCGCGGCT GAAACGGCTG GCCGGGCGGC GCTGGACCGG CGAGGGGGCC ATCGTCCTGC AATGTGACGA GACCCGCAGC
CAGGCCCGCA ACCGCGAGAT CGTGCGCGCC CGCCTGGTCG AGCTGATCGC CCGTGCGCTG GTCGCCCCGA AACGCCGCAT
CGCGACCAAG CCCACGCGCG GTTCGGTGCG GCGCCGTCTC GACTCCAAAA AGGCGCGCGG CGAGGTCAAG GCCCTGCGTG
GGAAGATCGG CGACGAATAG 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7