Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0128
Type: gene
Description:
Source: Genbank
Position: CP000031.2:135168..135923 (+ strand)
Length: 756
gbkey: Gene
gene: SPO0128
gene_biotype: protein_coding
load_id: gene-SPO0128
locus_tag: SPO0128
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00106
Source: Genbank
Position: CP000031.2:135168..135923 (+ strand)
Length: 756
"ID: cds-AAV93456.1
Dbxref: NCBI_GP:AAV93456.1
IMG: SPO0128: 3-ketoacyl-(acyl-carrier-protein) reductase
Note: identified by match to protein family HMM PF00106
RefSeq: SPO_RS00655: SDR family oxidoreductase"
gbkey: CDS
gene: SPO0128
locus_tag: SPO0128
parent_id: gene-SPO0128
product: oxidoreductase
  short chain dehydrogenase/reductase family
protein_id: AAV93456.1
transl_table: 11
translation: MNHMRLDGKTAIVTGGAQGFGAGIVAKFVSEGARVMVADINLDTARETAAQMDGDAFAHQ VDVSDGNSVDAMAAAALRRFGHVDILVNNAGVTHLPTAMEDVSEADFDRVYRVNMKSVYL TARALVPHMKDRGKGAILNVASTAGVSPRPRLNWYNASKGWMITATRTMAVELAPNGIRV NALNPVAGETPLLKSFMGEDTPEMRAKFLSTIPLGRFSTPQDMGNAACFLCSDEASMITG VAMEVDGGRCI
>SPO0128 class=Sequence position=CP000031.2:135168..135923 (+ strand)
GTGAACCATA TGAGACTGGA CGGAAAAACA GCCATCGTCA CCGGTGGCGC GCAAGGGTTC GGCGCCGGGA TCGTGGCGAA
ATTCGTGTCC GAGGGTGCCC GTGTCATGGT GGCCGATATC AACCTCGACA CCGCGCGCGA GACTGCCGCG CAGATGGATG
GCGATGCGTT TGCCCATCAG GTTGATGTGT CCGACGGCAA CTCGGTCGAC GCGATGGCGG CGGCGGCGCT GCGCAGGTTC
GGCCATGTGG ATATTCTGGT CAACAATGCC GGTGTCACCC ATCTGCCGAC CGCGATGGAA GATGTCAGCG AGGCGGATTT
CGACCGGGTC TACCGTGTCA ACATGAAGTC GGTCTATCTG ACCGCCCGGG CGCTGGTGCC GCATATGAAG GATCGCGGCA
AGGGCGCGAT CCTGAATGTC GCCTCGACCG CCGGAGTTTC TCCGCGACCC CGGCTGAACT GGTACAACGC CTCCAAGGGC
TGGATGATCA CCGCGACCCG CACCATGGCG GTAGAGCTTG CGCCAAATGG TATCCGCGTC AACGCGCTCA ACCCCGTGGC
GGGCGAGACC CCGCTGTTGA AATCCTTCAT GGGCGAGGAC ACGCCCGAGA TGCGCGCCAA GTTCCTGTCC ACCATCCCGC
TGGGCCGGTT CTCGACCCCG CAGGACATGG GCAATGCCGC CTGTTTCCTG TGTTCGGACG AGGCCTCGAT GATCACCGGC
GTCGCGATGG AGGTGGATGG CGGCCGCTGT ATCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7