Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0129
Type: gene
Description:
Source: Genbank
Position: CP000031.2:135951..136958 (+ strand)
Length: 1008
gbkey: Gene
gene: SPO0129
gene_biotype: protein_coding
load_id: gene-SPO0129
locus_tag: SPO0129
Parts:
Type: CDS
Description: identified by match to protein family HMM PF03576
Source: Genbank
Position: CP000031.2:135951..136958 (+ strand)
Length: 1008
"ID: cds-AAV93457.1
Dbxref: NCBI_GP:AAV93457.1
IMG: SPO0129: peptidase
  T4 family
Note: identified by match to protein family HMM PF03576
RefSeq: SPO_RS00660: P1 family peptidase"
gbkey: CDS
gene: SPO0129
locus_tag: SPO0129
parent_id: gene-SPO0129
product: peptidase
  T4 family
protein_id: AAV93457.1
transl_table: 11
translation: MVPGPRNLITDVPGLLVGNAQDDALKSGATVLSAEAPFMASVHVMGGAPGTRETDLLAPD KSVARIDALVLSGGSAYGLDACSGVSDALRAAGRGYRIADAVIPIVPGAIIFDLLNGGDK DWADNPYRALGRAAFDAAGRDFALGTTGAGTGALTAMLKGGLGSASLVLPDGTTVGALVA ANPMGSVTTPGDRHFWAAPFEIDGEFGGLGPDPSGGLGRQLESRKIRMMSAQAQDRANTT IAIVATDADLTKAQCQRMAVAAHDGIARATVPAHSPGDGDLVFSVSTGARPMAAPERDLT LLGHAAALCLARAIARAIYLARPAPGDLLPCWHQA
>SPO0129 class=Sequence position=CP000031.2:135951..136958 (+ strand)
ATGGTTCCCG GCCCCCGCAA CCTGATCACC GATGTGCCCG GCCTGTTGGT CGGCAATGCG CAGGACGATG CGTTGAAATC
CGGCGCCACC GTGCTGAGCG CCGAGGCGCC CTTCATGGCC TCGGTGCATG TGATGGGCGG GGCACCCGGC ACGCGCGAGA
CCGATCTGCT GGCGCCTGAC AAATCGGTGG CGCGGATCGA TGCGCTGGTG CTGTCGGGCG GGTCTGCCTA TGGGCTGGAT
GCCTGTTCGG GCGTCTCCGA TGCGCTGCGG GCCGCTGGGC GCGGCTATCG CATCGCCGAT GCGGTCATTC CCATTGTACC
TGGCGCCATC ATTTTTGACC TGCTCAATGG CGGGGACAAG GACTGGGCCG ACAACCCTTA TCGCGCGCTG GGCCGTGCCG
CGTTCGATGC GGCGGGCAGG GATTTCGCGC TGGGCACCAC CGGGGCGGGC ACCGGGGCGC TGACCGCGAT GCTCAAGGGT
GGGCTTGGTT CGGCCTCGCT GGTGCTGCCC GACGGAACCA CGGTGGGCGC GCTGGTTGCC GCCAATCCGA TGGGCAGTGT
CACCACCCCC GGAGATCGCC ATTTCTGGGC TGCCCCGTTC GAGATCGACG GCGAGTTCGG CGGGCTGGGT CCCGACCCCA
GCGGCGGGTT GGGCCGGCAG CTTGAAAGCC GCAAGATACG GATGATGTCC GCCCAGGCGC AGGACCGCGC CAATACCACC
ATCGCCATCG TTGCCACCGA TGCCGACCTG ACCAAGGCGC AATGCCAGCG GATGGCGGTG GCCGCCCATG ACGGCATCGC
CCGCGCCACG GTTCCGGCCC ATTCGCCGGG CGATGGCGAT CTGGTTTTCT CGGTTTCGAC CGGCGCCCGC CCGATGGCCG
CGCCCGAGCG TGACCTGACC TTGCTGGGTC ACGCTGCCGC GCTGTGCCTG GCCCGCGCCA TTGCCCGCGC CATCTATCTG
GCGCGCCCGG CGCCCGGTGA TCTGCTGCCC TGCTGGCATC AGGCGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7