Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0130
Type: CDS
Description: identified by match to protein family HMM PF00034
Source: Genbank
Position: CP000031.2:137081..137494 (+ strand)
Length: 414
Dbxref: NCBI_GP:AAV93458.1
IMG: SPO0130: cytochrome c family protein
Note: identified by match to protein family HMM PF00034
RefSeq: SPO_RS00665: cytochrome c550
gbkey: CDS
gene: SPO0130
load_id: cds-AAV93458.1
locus_tag: SPO0130
parent_id: gene-SPO0130
product: cytochrome c family protein
protein_id: AAV93458.1
transl_table: 11
translation: MNRFVAAAFACVLAVPALAEGDAAKGEKGFNKCKSCHMIESPAGETIVKGGKTGPNLYGV VGRAAGTYEGYKYGDSLVAAGEKGLVWDEESFVAFTQDPKSFLNTYLGETAAKSKMTFKL KSGGEDVFAYLQSVAAE
>SPO0130 class=Sequence position=CP000031.2:137081..137494 (+ strand)
ATGAACCGAT TTGTCGCCGC CGCCTTTGCC TGCGTTCTTG CCGTTCCCGC CCTCGCCGAG GGTGACGCCG CCAAGGGTGA
GAAGGGTTTC AACAAGTGCA AGTCCTGCCA CATGATCGAG AGCCCCGCGG GCGAGACCAT CGTCAAGGGC GGCAAGACCG
GGCCGAACCT GTATGGCGTC GTGGGCCGGG CCGCCGGCAC CTATGAAGGG TACAAATACG GTGACAGCCT GGTTGCTGCC
GGCGAAAAGG GTCTGGTCTG GGACGAAGAG AGCTTTGTCG CCTTCACCCA GGACCCCAAA AGCTTCCTGA ACACCTATCT
GGGTGAAACG GCGGCCAAGT CGAAAATGAC CTTCAAGCTT AAATCGGGTG GCGAGGACGT GTTCGCCTAT CTGCAAAGCG
TCGCCGCCGA ATAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7