Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0132
Type: CDS
Description: identified by match to protein family HMM PF00072; match to protein family HMM PF00512; match to protein family HMM PF02518
Source: Genbank
Position: CP000031.2:138223..140442 (- strand)
Length: 2220
Dbxref: NCBI_GP:AAV93460.1
IMG: SPO0132: sensor histidine kinase/response regulator
Note: identified by match to protein family HMM PF00072; match to protein family HMM PF00512; match to protein family HMM PF02518
RefSeq: SPO_RS00675: response regulator
gbkey: CDS
gene: SPO0132
load_id: cds-AAV93460.1
locus_tag: SPO0132
parent_id: gene-SPO0132
product: sensor histidine kinase/response regulator
protein_id: AAV93460.1
transl_table: 11
translation: MSLVNKLAEERRARLAAERLLELKQAELSAANRKLGRHALALTKQIGEKQAEVATVRDEN EKVKSDLTVANAKIEVAERRLWHSIQTIQDGFAFFDSDSKLIGANTAYLNVFDGLDEVAP GISYMRILQLMTEEGIIDTGELAAEEWRQMMHERWISPTPEPVVIRMWNDQYVKMIDQRG HGGDVVSLALNITSTVRYEAELRAAREKAEAANRAKSAFLANMSHEIRTPMNGVVGMAEL LCDTALDEEQQLYASTIKNSGEALLVIINDVLDYSKIEAEKMMLHPEPFDLERCIHEVAM LMQPIVRDKGLTLLVDYDLFLPTLFVGDPGRVRQVLTNLLGNAVKFTTKGHILIRVTGVP DPATGRCAIHVAIEDTGIGIPREKLAHIFGEFNQVENERNRQFDGTGLGLAISQRLIQMM GGTVWVESEEGRGSCFGFRVTLPMSEEAQPVLPNLPGRLQHVLIVDDLAVNRAILEKQLA QLGVRVTCCASGAQALEKMSDCVDLVLSDHNMPEMDGLELAEALRGAGWSDLPIFLLSSN PGMAHADPAKRHVQGILQKPIPRAELFARLSDMRTEITSVQDPAAVSAPVTKPAQDAPGE PTERRQMRVLAAEDNRTNQLVFRKMVKTLDIDLRFANNGLEAVEIWQDFQPDLIFMDISM PKMDGKQATGEIRRLEAGTGRHVPIVALTAHAMAGDAEGILAAGLDQYLTKPLRKALIHQ HIAEACPAGALPVEPESGE
>SPO0132 class=Sequence position=CP000031.2:138223..140442 (- strand)
ATGAGCCTGG TAAACAAGCT TGCCGAAGAG CGGCGCGCGC GTTTGGCCGC GGAAAGACTG CTGGAACTGA AGCAGGCCGA
ACTGTCGGCG GCCAATCGCA AGCTGGGGCG CCATGCGCTC GCGCTGACCA AGCAGATCGG CGAGAAACAG GCCGAGGTGG
CCACCGTTCG CGACGAAAAC GAGAAGGTCA AATCGGACCT GACCGTCGCC AATGCCAAGA TCGAGGTGGC CGAACGCCGC
CTGTGGCATT CGATCCAGAC CATTCAGGAC GGATTTGCCT TTTTCGATTC CGACAGCAAG CTGATCGGCG CCAATACCGC
CTATCTCAAC GTGTTTGACG GGCTGGACGA GGTGGCACCG GGCATCTCGT ACATGCGGAT CCTGCAACTG ATGACCGAGG
AAGGCATCAT CGACACCGGC GAACTGGCGG CAGAGGAATG GCGCCAGATG ATGCATGAGC GCTGGATCTC TCCCACCCCC
GAACCGGTGG TGATCCGCAT GTGGAACGAT CAATATGTCA AGATGATCGA CCAGCGCGGC CATGGCGGCG ATGTGGTCAG
CCTGGCGCTC AACATCACCT CGACCGTCCG CTACGAGGCC GAGCTGCGCG CCGCGCGCGA GAAGGCCGAA GCCGCCAATC
GCGCCAAATC CGCCTTTCTC GCCAATATGA GCCACGAGAT TCGCACGCCG ATGAATGGCG TGGTCGGGAT GGCCGAACTG
CTCTGCGATA CCGCCCTGGA CGAGGAACAG CAGCTTTATG CCAGCACGAT CAAGAATTCG GGCGAAGCGC TGCTGGTGAT
CATCAACGAT GTTCTCGACT ATTCCAAGAT CGAAGCCGAG AAGATGATGC TGCATCCCGA GCCCTTTGAC CTGGAACGTT
GCATTCACGA GGTCGCGATG CTGATGCAAC CCATCGTGCG CGACAAGGGG CTGACCCTGC TGGTGGATTA CGACCTGTTC
CTGCCCACCC TGTTTGTCGG CGATCCCGGT CGGGTGCGGC AGGTGCTGAC CAATCTTCTG GGCAATGCGG TCAAGTTCAC
GACCAAGGGT CACATCCTGA TCCGCGTCAC CGGTGTGCCC GATCCGGCCA CTGGCCGCTG CGCCATCCAT GTGGCGATCG
AGGATACCGG GATCGGCATC CCCAGGGAAA AGCTGGCGCA TATCTTTGGC GAGTTCAATC AGGTCGAGAA CGAACGCAAC
CGCCAGTTCG ACGGCACCGG ACTGGGTCTG GCGATCTCGC AGCGGCTGAT CCAGATGATG GGTGGCACCG TCTGGGTCGA
AAGCGAAGAG GGGCGCGGAT CGTGCTTCGG CTTTCGCGTC ACCCTGCCGA TGAGCGAGGA AGCGCAACCG GTTCTACCCA
ACCTGCCGGG CCGCCTGCAA CATGTCCTGA TTGTCGATGA CCTGGCGGTG AACCGTGCGA TCCTGGAAAA GCAGTTGGCC
CAGTTGGGTG TCCGGGTAAC CTGCTGCGCC TCGGGCGCCC AGGCGCTGGA AAAGATGAGC GATTGCGTCG ATCTGGTTCT
CAGCGATCAC AACATGCCCG AGATGGACGG GCTGGAACTG GCCGAGGCGC TGCGCGGCGC GGGCTGGAGC GATCTGCCGA
TCTTTCTGTT GTCGTCCAAT CCCGGCATGG CCCATGCCGA CCCGGCCAAA CGTCATGTGC AGGGTATTTT GCAAAAACCG
ATCCCACGGG CCGAATTGTT CGCGCGATTG TCCGACATGA GGACCGAGAT CACATCGGTG CAGGACCCGG CGGCCGTTTC
GGCACCCGTG ACCAAACCCG CCCAGGACGC CCCCGGCGAA CCGACCGAGC GCCGGCAGAT GCGGGTTCTT GCCGCCGAGG
ACAATCGCAC CAACCAGCTG GTGTTCCGCA AGATGGTCAA GACGCTGGAT ATCGACCTGC GCTTTGCCAA CAACGGGCTC
GAGGCGGTGG AGATCTGGCA GGACTTCCAG CCCGACCTGA TCTTCATGGA TATCTCGATG CCCAAGATGG ACGGCAAACA
GGCCACTGGC GAAATTCGCA GGCTCGAGGC CGGAACCGGC CGTCATGTTC CGATCGTTGC ACTGACCGCG CATGCCATGG
CCGGCGATGC CGAAGGCATC CTGGCCGCCG GGCTGGACCA GTATCTGACC AAACCCCTGC GCAAGGCGCT GATTCACCAG
CACATCGCCG AAGCCTGCCC GGCGGGCGCG CTGCCGGTCG AACCCGAAAG CGGAGAGTGA 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7