Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0133
Type: gene
Description:
Source: Genbank
Position: CP000031.2:140575..146001 (+ strand)
Length: 5427
gbkey: Gene
gene: SPO0133
gene_biotype: protein_coding
load_id: gene-SPO0133
locus_tag: SPO0133
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00024; match to protein family HMM PF01835; match to protein family HMM PF07703
Source: Genbank
Position: CP000031.2:140575..146001 (+ strand)
Length: 5427
Dbxref: NCBI_GP:AAV93461.1
IMG: SPO0133: PAN domain protein
Note: identified by match to protein family HMM PF00024; match to protein family HMM PF01835; match to protein family HMM PF07703
RefSeq: SPO_RS00680: PAN domain-containing protein
gbkey: CDS
gene: SPO0133
load_id: cds-AAV93461.1
locus_tag: SPO0133
parent_id: gene-SPO0133
product: PAN domain protein
protein_id: AAV93461.1
transl_table: 11
translation: MRRFGFLAILSLQLAFFGVSGLSAQEAAPGFRYLATRDMDFYGEDLDALFDTDLQSCIRA CSANNACNAFTFNARSNACFPKRGVSEQTPYQGALSAVKLPSPAAVRDRARQQAARLAFL PDRDLTRAVAQARDLGLRYAAGGMELDQVIAAMRNAGEGAQAAGWAGLAVSLSDRADLWA EYARLLLSVRSDDSSIKRDHARRAVSAAINAYLRADRPGAEVSALALLAQALERDGRGRD MVPVLRLASDIQPREDVLAALDRAIGKYGFRVVETTVESDSAQPRICAQFSDPLARSGVD YEPFVHSPEGDLVVQADGNQLCLDGVEHGKRYRITLRAGLPAGSGEALWKDVTLTHYVRD RSPAVRFPGRSYVLPKSADAAIPVETVNATTLDLILRRVSDRNLLRAVQEGYFARPLSYW EDEHFASDIAQEVWTGSAEVASTLNRDMTTRLPLAEAISGQAAGIYTLTARVPGADPYDN PGATQWFVLSDLGLSSISGNDGLHVSVRGLSDAAPRAAVDLTLISRANAVLGRVQTDAQG LARFEPGLTRGTGAAAPALILATAGDTDLGFLSLIDPAFDLSDRGVEGRKPAGPVDVFLT TDRGAYRAGETIHATALSRDGTARAIDGLPLTAILTRPDGVEYGRKVSDGGVAGGHVFAL TTGASAPRGTWRLDIKADPDGPALASQTLLVEDFLPERIDFDLALPDAPILPGDSPPLSI EARYLFGAPGADLSIEGQVQLRAADQIAGWPGYRFGRHDAGLQTRTSHFGDARTDAAGNA RLAVEIPQIDAEGKPLEAVVTARLADGAARPVERRISVPVSPATPVIGIKPLFEDVVSEG TEAGFQVIGLTPDLTPQPMRIKWTLNRVETRYQWYQLYGNWNWEPVTRRTRIATGEADLG SDPLSLSQPVEWGEYELLVERLDGAYVASSADFYAGWYQAADAAATPDRLELSLDKDSYR PGDTARLRIVPRMAGTALVTVLSDRVIARQAVEVAAGESVIPLTVTEDWGTGAYVTATVI RPMDVAAGQNPARALGLAHATIEPVGKALTVAIDAPEVAKPRATQPVRLTVAGAQAGDEV WLTLAAVDLGILNLTGFQSPDPQGHYFGQRRLGVEMRDVYGRLIDGMNGAMGIVRSGGDA DNGLRMQSPPPTQDLMAVFSGPVQVGADGGVSVDVPLPAFNGTVRLMAVAWSDQAVGQAE RDMIVRDPVVVTATVPRFLAPGDSSRLRLEVVHADGPPGEMALKLASAPGLQLGAAPDRF TLTEGGKAVFEVPVTATALGDPVLTVELETPGGQELRQVLRLPVRANDPVVAQTRRFALG AGDSFLFSRDVFTGLRPGSARAILSAGPLARFDAPGLLGVLDRYPYGCTEQVTSQAMPLL YLGAVAQAAGLGTGPQVAERIDAAIRRILTRQSANGAFGLWRAESGDFWLDAYASDFLSR ARAEGYALPDRAFAMAMDNLRNRLNYAPDFDEGGEDIAYALMVLAREGAAAMGDLRYYAD VKADAFTTPLGAAQLGSALAMYGDQTRADAMFARAARMVAGQRPEAPVWRADYGTSLRDA AGLLTLAAEAGSAVIDRDSLISRISQPAGEMSTQEAAWSLLAAQALVKQPEQSGLRVNGA AVDGPFVQVLAGTSDEVLNITAVDGGATDITLTMLGVPEVPLPAGGTGYTITRARYTMDG APIQRDAFAIGERFVTVLTVTPFEASGGRLMVNDPLPAGFEIDNPSLLRSGDVRALDWLS LDEASHTEFRSDRFLAAVDLYGTRPVTLAYVTRAVSPGAFHHPAASVEDMYRPRYRARTD TGRIRVGQ
>SPO0133 class=Sequence position=CP000031.2:140575..146001 (+ strand)
ATGCGACGTT TTGGATTTCT TGCAATTCTT TCTCTTCAGT TGGCTTTTTT CGGGGTGTCG GGCCTCTCGG CACAAGAGGC
CGCGCCCGGT TTTCGCTATC TCGCCACCCG CGACATGGAT TTTTATGGCG AGGATCTGGA CGCGCTGTTC GATACCGATC
TGCAATCCTG CATCCGGGCC TGCTCGGCAA ACAACGCTTG TAACGCTTTC ACCTTCAACG CGCGCTCGAA CGCCTGTTTC
CCCAAACGCG GCGTCAGCGA GCAGACGCCT TATCAGGGGG CGCTGTCGGC GGTGAAACTG CCCAGCCCGG CGGCGGTGCG
TGACCGGGCG CGTCAACAAG CGGCGCGGCT GGCTTTCCTC CCGGACCGCG ACCTGACCCG CGCTGTCGCG CAGGCGCGCG
ATCTGGGACT GCGCTATGCC GCCGGCGGGA TGGAGTTGGA TCAGGTCATC GCTGCGATGC GCAACGCGGG CGAGGGGGCG
CAGGCCGCCG GATGGGCCGG GCTGGCGGTG TCGCTGTCGG ATCGTGCCGA TCTGTGGGCC GAATACGCCC GCCTGCTGCT
GAGTGTTCGC AGCGATGACA GCAGCATTAA ACGCGACCAT GCGCGCCGGG CGGTTTCGGC TGCGATCAAC GCCTATTTGC
GGGCGGATCG TCCCGGCGCC GAAGTTTCGG CGCTGGCCCT GCTGGCGCAG GCACTGGAAC GGGACGGGCG CGGCCGTGAC
ATGGTGCCGG TGCTGCGGCT GGCCAGTGAC ATCCAGCCGC GCGAGGACGT GCTGGCGGCG CTGGATAGGG CAATTGGCAA
ATACGGGTTC CGCGTGGTCG AGACCACGGT CGAAAGCGAC AGCGCCCAGC CGCGCATCTG CGCCCAGTTC TCGGACCCGT
TGGCGCGCAG CGGTGTCGAT TACGAGCCCT TCGTTCACTC GCCCGAGGGG GATCTGGTCG TGCAGGCCGA TGGCAACCAG
CTGTGTCTTG ACGGTGTCGA ACATGGCAAA CGCTATCGCA TCACCCTGCG TGCGGGGCTG CCGGCTGGAT CCGGTGAGGC
GCTCTGGAAG GACGTGACGC TGACCCATTA CGTGCGAGAC CGCAGCCCGG CGGTGCGTTT CCCGGGTCGG TCCTATGTGC
TGCCGAAATC GGCGGATGCG GCGATACCGG TCGAGACGGT GAACGCCACC ACGCTTGATC TGATCTTGCG GCGGGTCAGC
GACCGCAACC TGCTGCGCGC GGTGCAGGAG GGGTATTTCG CGCGCCCGCT GTCCTATTGG GAAGACGAGC ATTTCGCTTC
CGATATCGCG CAAGAGGTCT GGACCGGCAG TGCCGAAGTG GCCAGCACGC TCAACCGCGA CATGACCACC CGCTTGCCAT
TGGCAGAGGC GATCTCGGGC CAGGCGGCCG GTATCTATAC GCTGACGGCG CGGGTGCCGG GGGCTGACCC CTATGACAAT
CCCGGTGCCA CCCAATGGTT CGTGCTGTCC GATCTGGGCC TGTCCTCGAT CTCAGGCAAT GACGGGCTGC ATGTTTCTGT
GCGCGGTCTT TCCGACGCGG CGCCCCGCGC AGCGGTTGAC CTGACGCTGA TCTCGCGTGC CAATGCGGTG CTGGGCCGGG
TCCAGACCGA TGCACAGGGG CTGGCGCGGT TCGAACCGGG GCTGACGCGG GGCACGGGCG CGGCGGCGCC AGCGTTGATC
CTGGCAACGG CGGGCGACAC CGATCTGGGG TTCCTGTCGC TGATCGACCC GGCCTTTGAC CTGTCCGACC GGGGCGTCGA
GGGGCGCAAG CCCGCGGGCC CCGTCGATGT GTTCCTGACC ACCGACCGGG GCGCCTATCG TGCGGGCGAG ACCATTCATG
CCACAGCCCT CAGCCGCGAT GGCACCGCGC GCGCCATCGA CGGCCTGCCA CTGACCGCGA TCCTGACCCG GCCCGACGGG
GTGGAATATG GCCGCAAGGT CTCGGATGGT GGCGTTGCAG GGGGGCATGT CTTTGCGCTG ACCACCGGTG CCAGCGCCCC
GCGCGGCACT TGGCGGTTGG ATATCAAGGC CGATCCCGAC GGGCCAGCGC TGGCCAGCCA GACCCTGCTG GTCGAGGATT
TCCTGCCCGA GCGGATCGAT TTTGACCTGG CGCTGCCCGA TGCGCCGATC CTGCCCGGCG ACAGCCCGCC GCTGAGCATC
GAGGCGCGCT ATCTGTTCGG GGCGCCGGGC GCCGATCTGA GCATCGAGGG ACAGGTGCAA TTGCGCGCCG CCGACCAGAT
CGCGGGCTGG CCCGGATACC GGTTTGGCCG CCATGACGCC GGGCTTCAGA CCCGCACCAG CCATTTCGGC GATGCCCGCA
CCGATGCGGC GGGCAATGCC CGGCTGGCGG TCGAGATCCC GCAGATCGAC GCCGAGGGCA AACCGCTCGA GGCAGTGGTG
ACGGCGCGGC TGGCCGATGG CGCCGCCCGC CCGGTCGAAC GCCGGATCTC GGTGCCGGTC TCGCCGGCCA CCCCCGTTAT
CGGCATCAAG CCGCTGTTCG AGGATGTGGT GAGCGAGGGT ACCGAGGCTG GATTCCAGGT GATCGGCCTG ACCCCGGACC
TGACGCCCCA GCCCATGCGG ATCAAATGGA CGCTGAACCG GGTCGAGACG CGGTATCAGT GGTACCAGCT TTACGGCAAC
TGGAACTGGG AGCCGGTGAC CCGCCGCACC CGCATCGCTA CCGGCGAGGC CGATCTGGGC AGCGATCCGC TGTCCCTGTC
GCAGCCGGTG GAATGGGGTG AATACGAACT CCTCGTCGAG CGGCTGGATG GGGCCTATGT CGCCTCCTCT GCCGATTTCT
ATGCCGGCTG GTATCAGGCC GCCGATGCGG CGGCGACGCC CGATCGGCTG GAGCTTTCGC TGGACAAGGA CAGCTATCGC
CCGGGCGACA CCGCGCGGCT GCGGATCGTG CCGCGCATGG CGGGCACCGC GCTGGTCACG GTGCTGTCGG ACCGGGTGAT
CGCGCGGCAG GCGGTCGAGG TGGCAGCGGG CGAAAGCGTG ATCCCACTTA CGGTGACCGA GGATTGGGGC ACCGGCGCCT
ATGTCACCGC AACGGTGATC CGGCCGATGG ACGTGGCCGC CGGGCAGAAC CCGGCGCGTG CACTGGGTCT GGCCCATGCA
ACGATAGAAC CGGTGGGCAA GGCGCTGACG GTTGCGATCG ACGCGCCCGA GGTGGCCAAA CCGCGCGCCA CCCAGCCCGT
GCGCCTGACG GTTGCGGGCG CGCAGGCGGG TGACGAGGTC TGGCTGACGC TGGCGGCAGT CGATCTGGGC ATCCTGAACC
TCACCGGCTT CCAGAGTCCC GATCCGCAGG GTCACTATTT TGGCCAGCGG CGGCTGGGGG TCGAGATGCG CGATGTCTAT
GGCCGGTTGA TCGACGGCAT GAACGGCGCC ATGGGGATCG TGCGCTCGGG CGGGGATGCC GATAATGGCC TGCGGATGCA
ATCGCCGCCG CCGACCCAGG ACCTGATGGC GGTGTTCAGT GGCCCGGTGC AGGTGGGTGC CGATGGCGGC GTTTCGGTCG
ATGTGCCCTT GCCCGCCTTC AACGGCACTG TGCGTCTGAT GGCGGTGGCC TGGTCAGACC AAGCGGTCGG ACAGGCCGAG
CGGGACATGA TCGTGCGCGA TCCGGTGGTG GTGACGGCGA CGGTGCCGCG CTTCCTTGCG CCCGGCGACA GCAGCCGGTT
GCGGCTGGAG GTGGTGCATG CCGATGGCCC GCCGGGCGAG ATGGCGCTGA AACTGGCCAG TGCCCCGGGC CTGCAATTGG
GCGCCGCGCC CGACCGGTTC ACCTTGACCG AGGGTGGCAA GGCCGTGTTC GAGGTGCCGG TCACCGCCAC CGCGCTGGGC
GATCCAGTGT TGACGGTCGA ATTGGAGACG CCGGGCGGGC AAGAGCTGCG CCAGGTGCTA AGGCTGCCGG TGCGCGCCAA
TGATCCGGTG GTGGCCCAGA CCCGGCGCTT TGCGTTGGGG GCAGGCGACA GTTTCCTGTT CTCGCGCGAT GTCTTCACCG
GGCTCAGGCC CGGATCGGCC CGCGCCATCC TGTCGGCCGG GCCGCTGGCG CGGTTTGATG CGCCGGGCCT GTTGGGGGTG
CTCGACCGGT ATCCCTATGG CTGCACCGAA CAGGTGACCT CGCAGGCGAT GCCGCTGCTT TACCTTGGTG CGGTGGCACA
GGCGGCGGGG CTGGGCACCG GGCCGCAGGT GGCCGAGCGG ATCGACGCCG CGATCCGGCG CATCCTGACC CGGCAAAGCG
CCAATGGCGC CTTTGGCCTG TGGCGTGCCG AGAGCGGTGA TTTCTGGCTC GACGCCTATG CCTCGGACTT TCTCAGCCGG
GCCCGGGCCG AAGGCTATGC CCTACCGGAC CGCGCCTTTG CCATGGCGAT GGACAACCTG CGCAATCGGT TGAACTATGC
CCCCGATTTC GACGAAGGGG GCGAGGATAT CGCTTATGCC CTGATGGTGC TGGCGCGCGA GGGCGCGGCG GCGATGGGCG
ATCTGCGCTA TTACGCCGAC GTCAAGGCGG ATGCCTTTAC CACGCCGCTG GGCGCGGCAC AGCTGGGGTC GGCGCTGGCC
ATGTATGGCG ACCAGACGCG GGCCGACGCG ATGTTTGCCC GCGCCGCGCG CATGGTCGCG GGGCAGCGGC CTGAGGCACC
CGTCTGGCGG GCCGATTACG GTACCAGCCT GCGCGATGCG GCGGGCCTGT TGACGCTGGC CGCCGAGGCG GGCAGTGCGG
TGATCGACCG GGATTCCCTG ATCAGCCGCA TCAGCCAGCC TGCGGGTGAG ATGTCGACCC AGGAAGCGGC CTGGAGCCTG
CTTGCGGCGC AGGCCCTGGT GAAACAGCCC GAACAATCGG GCCTGCGGGT GAATGGCGCG GCGGTGGATG GGCCCTTTGT
GCAGGTGCTT GCAGGGACCA GCGACGAGGT GCTCAACATC ACCGCCGTCG ATGGTGGCGC CACCGATATC ACCCTGACCA
TGCTGGGTGT ACCCGAGGTT CCGCTGCCCG CCGGTGGTAC CGGCTACACC ATCACCCGCG CCCGCTACAC GATGGACGGG
GCGCCCATCC AGCGCGACGC TTTCGCCATT GGCGAACGGT TCGTGACGGT GCTGACCGTG ACCCCGTTCG AGGCCTCGGG
CGGGCGGCTG ATGGTGAACG ATCCGCTGCC CGCAGGGTTC GAGATCGATA ACCCCTCGCT GTTGCGTTCG GGCGATGTGC
GGGCGCTGGA CTGGCTGTCG CTGGACGAGG CCAGCCATAC CGAGTTCCGC AGCGACCGCT TCCTGGCGGC GGTCGATCTG
TACGGCACCC GGCCCGTCAC GCTGGCCTAT GTCACCCGCG CGGTGAGCCC GGGCGCGTTC CACCACCCGG CGGCCTCGGT
CGAGGACATG TACCGCCCCC GCTATCGTGC CCGCACCGAC ACGGGCCGCA TCCGTGTCGG GCAATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7