Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0134
Type: gene
Description:
Source: Genbank
Position: CP000031.2:145998..146564 (+ strand)
Length: 567
gbkey: Gene
gene: SPO0134
gene_biotype: protein_coding
load_id: gene-SPO0134
locus_tag: SPO0134
Parts:
Type: CDS
Description: identified by similarity to GB:BAB50328.1
Source: Genbank
Position: CP000031.2:145998..146564 (+ strand)
Length: 567
Dbxref: NCBI_GP:AAV93462.1
IMG: SPO0134: hypothetical protein
Note: identified by similarity to GB:BAB50328.1
RefSeq: SPO_RS00685: putative glycolipid-binding domain-containing protein
gbkey: CDS
gene: SPO0134
load_id: cds-AAV93462.1
locus_tag: SPO0134
parent_id: gene-SPO0134
product: hypothetical protein
protein_id: AAV93462.1
transl_table: 11
translation: MSGREAVATAHWRRLDGEGSDRCTLSRVAQGWIMVGHAHWRDEGCDTTLSYDIRCAPDWR SLSADVAGERGGRPLSMRIEATPMGWRMDDVLQPGTEDCSDLDLSFTPATNLMPIRRLGA FAGDELRVAAAWLMPDLDCVARLDQIYTRLPDGRVHYASAGFAADLDLHGSGFTTLYPGL WQGWVDDA
>SPO0134 class=Sequence position=CP000031.2:145998..146564 (+ strand)
ATGAGCGGGC GCGAGGCGGT GGCCACCGCC CATTGGCGGC GGCTGGATGG CGAAGGCTCC GACCGCTGCA CCCTTTCGCG
GGTGGCGCAG GGCTGGATCA TGGTGGGCCA CGCCCATTGG CGCGACGAGG GCTGTGATAC CACGCTCAGC TATGACATCC
GCTGCGCACC CGACTGGCGC AGCCTGTCGG CGGATGTGGC CGGAGAGCGT GGTGGTCGCC CCCTGTCGAT GCGGATCGAG
GCGACGCCGA TGGGCTGGCG GATGGACGAC GTGCTGCAAC CGGGCACCGA GGATTGCAGC GATCTGGACC TCAGCTTTAC
CCCGGCGACC AACCTGATGC CGATACGGCG GCTGGGGGCC TTTGCGGGCG ACGAGTTGCG CGTTGCCGCC GCCTGGCTTA
TGCCCGACCT GGATTGCGTG GCGCGGCTGG ATCAGATCTA TACCCGGTTG CCGGATGGTC GGGTGCATTA TGCCTCGGCC
GGGTTTGCGG CGGATCTCGA CCTGCATGGC AGCGGTTTTA CCACCCTTTA TCCCGGGCTC TGGCAGGGTT GGGTCGATGA
TGCCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7