Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0140
Type: CDS
Description: identified by similarity to PIR:E83277; match to protein family HMM PF06938
Source: Genbank
Position: CP000031.2:155346..155927 (+ strand)
Length: 582
Dbxref: NCBI_GP:AAV93468.1
IMG: SPO0140: hypothetical protein
Note: identified by similarity to PIR:E83277; match to protein family HMM PF06938
RefSeq: SPO_RS00715: DUF1285 domain-containing protein
gbkey: CDS
gene: SPO0140
load_id: cds-AAV93468.1
locus_tag: SPO0140
parent_id: gene-SPO0140
product: hypothetical protein
protein_id: AAV93468.1
transl_table: 11
translation: MSGQKPVKPSADGLLASARAIKSKGPAPVHLWNPPFNGDIDMRIARDGTWFYQGTPINRP AMVRLFSSILKREEDRFYLVTPVEKVGIRVDDAPFVAVDVEVAGQGRKQVLTFTTHVGDS AVAGEGNPIRMAQDPATGEPAPYVHVRAGLEALIDRKSFYRLMDLGEIEDGWFGLWSSGS FFPLMTVEELERG
>SPO0140 class=Sequence position=CP000031.2:155346..155927 (+ strand)
ATGAGCGGAC AAAAGCCTGT GAAACCTTCG GCGGACGGCC TTCTTGCCTC GGCCCGGGCG ATTAAATCCA AGGGGCCGGC
GCCCGTGCAT CTGTGGAACC CGCCTTTCAA CGGGGATATC GACATGCGCA TCGCGCGGGA CGGGACGTGG TTCTATCAGG
GCACGCCGAT CAACCGGCCC GCGATGGTGC GGCTGTTCTC GTCGATCCTG AAACGTGAAG AGGACCGGTT CTATCTGGTC
ACCCCGGTCG AAAAGGTCGG GATTCGCGTC GATGACGCGC CATTTGTCGC CGTGGATGTC GAGGTTGCGG GCCAGGGGCG
CAAGCAGGTG CTGACCTTTA CCACCCATGT GGGCGACAGC GCGGTGGCGG GGGAGGGCAA TCCGATCCGG ATGGCACAGG
ACCCCGCAAC CGGGGAACCC GCGCCCTATG TTCATGTCCG CGCGGGGCTT GAGGCGCTGA TCGACCGCAA GAGCTTCTAT
CGGCTGATGG ATCTGGGTGA GATCGAGGAC GGCTGGTTCG GCCTGTGGTC TTCGGGCAGC TTCTTTCCCC TGATGACGGT
CGAGGAGCTG GAGCGCGGCT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7