Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO2042
Type: CDS
Description: identified by match to protein family HMM PF01209
Source: Genbank
Position: CP000031.2:2172940..2173797 (+ strand)
Length: 858
"ID: cds-AAV95314.1
Dbxref: NCBI_GP:AAV95314.1
IMG: SPO2042: methyltransferase
  UbiE/COQ5 family
Note: identified by match to protein family HMM PF01209
RefSeq: SPO_RS10360: class I SAM-dependent methyltransferase"
gbkey: CDS
gene: SPO2042
locus_tag: SPO2042
parent_id: gene-SPO2042
product: methyltransferase
  UbiE/COQ5 family
protein_id: AAV95314.1
transl_table: 11
translation: MTETNHDQAEYWGKSASGMKWLTFEEQIAASFAPVVDLLLERAALKPGQRVLDIGCGLGD VTLAAAQAVGPGGHVLGVDISAPFLERAGLRASGMGNVGFALADAQSEPFAPAERDAVLS RFGMMFFSDTVAAFANIARALKPGGRMTFAAWGPLAGNPWFYLPHRAATDRLGQMPKVDR NAPGPLAFHDIDRVTGLMAEAGLADIEAQAVDLNLTPPGGLEGAAALCTRLGPAARVLAH FNGSEADEAAIRDAVSAALEPYVEGGEVLMPATINLFQARRAGTA
>SPO2042 class=Sequence position=CP000031.2:2172940..2173797 (+ strand)
ATGACAGAGA CGAACCACGA CCAGGCCGAG TATTGGGGCA AATCCGCCTC GGGCATGAAA TGGCTGACCT TCGAAGAGCA
GATCGCCGCC TCTTTCGCGC CGGTGGTCGA TCTTCTGCTG GAACGTGCCG CGCTGAAACC CGGCCAGCGC GTGCTCGATA
TCGGCTGCGG CCTGGGCGAC GTCACCCTGG CGGCCGCTCA GGCGGTGGGT CCGGGCGGCC ATGTGTTGGG GGTCGATATC
TCGGCGCCCT TCCTTGAGCG CGCCGGGCTC CGGGCTAGCG GCATGGGAAA CGTTGGTTTT GCCCTCGCCG ACGCCCAGAG
CGAGCCCTTT GCGCCGGCAG AGCGCGACGC GGTGCTCTCA CGTTTCGGCA TGATGTTCTT TTCCGACACC GTGGCCGCAT
TCGCCAACAT CGCCCGGGCG CTGAAGCCCG GCGGTCGCAT GACATTTGCC GCCTGGGGGC CGCTGGCCGG AAACCCCTGG
TTCTACCTTC CCCACCGCGC GGCCACGGAC CGGCTGGGCC AGATGCCCAA GGTCGACCGC AACGCGCCCG GGCCGCTGGC
GTTTCACGAT ATCGACCGGG TCACCGGCCT GATGGCGGAG GCGGGTCTGG CCGATATCGA GGCGCAGGCC GTCGACCTGA
ACCTGACCCC ACCCGGCGGG CTGGAGGGGG CCGCGGCGCT CTGCACCCGA TTGGGACCGG CCGCGCGGGT ACTGGCGCAT
TTCAACGGGT CCGAGGCGGA CGAAGCCGCG ATCCGCGACG CGGTCAGCGC GGCGCTGGAA CCTTATGTCG AGGGCGGCGA
GGTTCTCATG CCCGCCACCA TCAACCTGTT CCAGGCCCGG CGCGCGGGAA CCGCTTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7