Roseobase: Ruegeria pomeroyi DSS-3

Name: SPOA0354
Type: CDS
Description: identified by match to protein family HMM PF00202; NCBI:aspartateaminotransferasefamilyprotein; IMG:4-aminobutyrate aminotransferase
Source: GenBank
Position: DSS3:4505135..4506433 (+ strand)
Length: 1299
Dbxref: GI:56709136
  GeneID:3196988
Note: identified by match to protein family HMM PF00202
  NCBI:aspartateaminotransferasefamilyprotein
  IMG:4-aminobutyrate aminotransferase
codon_start: 1
load_id: SPOA0354.p01
parent_id: SPOA0354.t01
product: aminotransferase, class III
protein_id: REF_tigr:SPOA0354
  YP_165181.1
transl_table: 11
translation: MTPDTQALLDRRARLLGPNVSLFYDEPVHVVRGQGVWLWDNDGNRYLDCYNNVPHVGHCH PRVVEAIATQAATLNTHTRYLHEGILDYVEALTATFDAPLDTAILTCTGSEANDIALRMA QAVTGNTGVIATDHTYHGNTMAVSQLSRTNPPPGGYWDNMAFVPAPDSYRPLGGVPGPAH ALAFAAAVQGQIEALAARGHKLACLILCPYFANEGFPTLEPGWLAPAIEAVRRAGGIVIA DEVQPGFGRLGSHFWGHQKAGIQPDVVTLGKPMANGHPVGGVVTSPEIMAAFRERFRYFN TFGGNPVSAAAALATLKVVQDEGLMENARAVGDYAREGLRDLAGRHECIGDVRGSGLFFG AELVLDRTDKTPATAFAKRVANAMRQRGVLLNFLGIHYNTLKIRPPMPFSRDNADQLIET LDAVLSETPFVP
>SPOA0354 class=Sequence position=DSS3:4505135..4506433 (+ strand)
ATGACACCGG ACACACAGGC CTTGCTTGAT CGGCGCGCGC GCCTGTTGGG GCCGAATGTC AGCCTGTTCT ATGACGAACC
GGTGCATGTG GTCCGGGGGC AGGGGGTCTG GCTGTGGGAC AACGACGGCA ACAGATATCT TGACTGCTAT AACAACGTGC
CCCATGTGGG GCATTGTCAC CCGCGCGTGG TCGAGGCCAT CGCGACGCAG GCCGCGACGC TGAACACCCA TACCCGCTAT
CTGCACGAGG GTATCCTCGA CTATGTCGAG GCGCTGACGG CGACCTTTGA TGCGCCGCTG GACACCGCGA TCCTGACCTG
TACCGGCTCC GAGGCGAACG ATATCGCGCT GCGCATGGCA CAGGCGGTTA CCGGCAACAC AGGGGTGATC GCGACCGATC
ACACCTATCA CGGCAACACG ATGGCGGTGT CTCAGCTGTC GCGCACCAAT CCGCCGCCGG GCGGGTATTG GGACAATATG
GCCTTTGTGC CCGCGCCCGA CAGCTATCGC CCCTTGGGCG GCGTTCCAGG CCCGGCGCAT GCGCTGGCCT TTGCCGCCGC
CGTGCAGGGG CAGATCGAGG CGCTGGCCGC GCGCGGACAC AAGCTCGCCT GCCTGATCCT CTGTCCCTAT TTCGCCAACG
AGGGCTTTCC CACGCTGGAA CCCGGCTGGC TCGCCCCCGC AATCGAGGCG GTGCGCCGCG CCGGTGGCAT CGTGATCGCG
GATGAGGTGC AGCCGGGTTT TGGCCGCCTG GGCAGCCATT TCTGGGGGCA TCAGAAGGCG GGTATTCAAC CCGATGTGGT
CACCCTGGGC AAACCCATGG CCAATGGCCA CCCGGTGGGC GGGGTCGTGA CCAGCCCCGA GATCATGGCG GCGTTTCGCG
AGCGGTTCCG CTATTTCAAC ACCTTTGGCG GCAACCCGGT TTCGGCGGCC GCCGCGCTGG CGACGCTGAA AGTGGTGCAG
GACGAAGGGC TGATGGAGAA CGCGCGCGCG GTGGGTGACT ATGCCCGCGA GGGCCTGCGC GACCTCGCCG GGCGTCACGA
ATGCATCGGC GATGTGCGCG GGTCGGGGTT GTTCTTTGGG GCCGAGCTGG TGCTGGACCG GACCGACAAG ACCCCGGCCA
CCGCCTTTGC CAAGCGTGTC GCCAACGCGA TGCGGCAGCG GGGCGTGCTG CTGAACTTTC TGGGTATTCA CTACAACACG
TTGAAGATCC GCCCGCCCAT GCCGTTCAGC CGCGACAATG CCGACCAGTT GATCGAAACA CTGGACGCCG TCCTGTCCGA
AACGCCGTTT GTGCCGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7