Roseobase: Ruegeria pomeroyi DSS-3

Name: SPOA0355
Type: gene
Description:
Source: GenBank
Position: DSS3:4506430..4507374 (+ strand)
Length: 945
Dbxref: GeneID:3196989
load_id: SPOA0355
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:4506430..4507374 (+ strand)
Length: 945
load_id: SPOA0355.t01
parent_id: SPOA0355
Parts:
Type: CDS
Description: identified by similarity to GB:AAN34322.1; NCBI:homoserinekinase; IMG:Ser/Thr protein kinase RdoA involved in Cpx stress response; MazF antagonist
Source: GenBank
Position: DSS3:4506430..4507374 (+ strand)
Length: 945
Dbxref: GI:56709137
  GeneID:3196989
Note: identified by similarity to GB:AAN34322.1
  NCBI:homoserinekinase
  IMG:Ser/Thr protein kinase RdoA involved in Cpx stress response
  MazF antagonist
codon_start: 1
load_id: SPOA0355.p01
parent_id: SPOA0355.t01
product: hypothetical protein
protein_id: REF_tigr:SPOA0355
  YP_165182.1
transl_table: 11
translation: MTAAVARALTLWGLDGASYELAAQRENEVWKVSDGTRHYALRFHRPAYRSEAELTSELLW VEMLGQAGMQVPQPVRQPDGAVLGRIEGRHVSLLDWLGGRPLGKMGQLAPDLDAEAVGRM IGAQMARMHDLSDRWTPPAGFQRPDWRRSGLLGADPLWGRFWEHPDLDPAQRQLMIATRE RALACFEDFAPGADQGLIHADLVVENVLVDHDRVAFIDFDDGAWGYRDFDLATVLVKFIG QPDYDRLRAGLCAGYDARRRVEPGTLDFMLLLRALTYPGWIMSRLDEPGGRQRSARMLDT ALRLARDFMEERQR
Type: exon
Description:
Source: GenBank
Position: DSS3:4506430..4507374 (+ strand)
Length: 945
parent_id: SPOA0355.t01
> class=Sequence position=DSS3:4506430..4507374 (+ strand)
GTGACCGCCG CTGTCGCCCG CGCCTTGACA CTCTGGGGCC TCGACGGGGC CAGCTATGAG CTGGCCGCAC AGCGGGAAAA
CGAGGTCTGG AAGGTGTCGG ACGGCACGCG CCACTATGCG CTGCGCTTTC ACCGACCCGC GTATCGGAGC GAGGCCGAGC
TGACCTCGGA ATTGCTCTGG GTCGAGATGC TGGGGCAGGC GGGGATGCAG GTGCCCCAAC CGGTGCGCCA GCCGGATGGC
GCCGTACTGG GCCGGATCGA GGGGCGCCAT GTCAGTCTGC TCGATTGGCT TGGCGGGCGA CCGCTGGGCA AGATGGGGCA
GTTGGCGCCG GATCTGGATG CCGAGGCCGT GGGCCGGATG ATCGGGGCGC AAATGGCGCG TATGCACGAC CTGTCGGACC
GCTGGACGCC GCCCGCGGGT TTCCAGCGCC CCGACTGGCG GCGTTCGGGT CTGCTGGGGG CGGACCCGCT CTGGGGTCGC
TTCTGGGAGC ATCCCGACCT CGACCCCGCG CAACGGCAGC TGATGATCGC GACCCGTGAG CGCGCGCTGG CGTGTTTCGA
GGATTTCGCG CCGGGGGCCG ATCAGGGCTT GATCCATGCC GATCTGGTCG TCGAGAATGT GCTGGTTGAC CACGATCGCG
TAGCGTTCAT AGATTTTGAC GACGGCGCCT GGGGGTATCG GGATTTCGAC CTTGCCACGG TTCTGGTCAA GTTCATCGGC
CAGCCTGATT ACGACAGGCT GCGGGCGGGC CTGTGCGCGG GCTATGACGC GCGCCGCAGG GTCGAGCCCG GCACGCTTGA
TTTCATGCTG CTGCTGCGGG CGCTGACCTA TCCGGGCTGG ATCATGTCAC GGCTGGACGA GCCGGGCGGG CGGCAAAGAT
CGGCGCGCAT GCTGGACACC GCGCTGCGGC TGGCCAGGGA TTTCATGGAG GAGAGGCAGA GATGA
>SPOA0355 class=Sequence position=DSS3:4506430..4507374 (+ strand)
GTGACCGCCG CTGTCGCCCG CGCCTTGACA CTCTGGGGCC TCGACGGGGC CAGCTATGAG CTGGCCGCAC AGCGGGAAAA
CGAGGTCTGG AAGGTGTCGG ACGGCACGCG CCACTATGCG CTGCGCTTTC ACCGACCCGC GTATCGGAGC GAGGCCGAGC
TGACCTCGGA ATTGCTCTGG GTCGAGATGC TGGGGCAGGC GGGGATGCAG GTGCCCCAAC CGGTGCGCCA GCCGGATGGC
GCCGTACTGG GCCGGATCGA GGGGCGCCAT GTCAGTCTGC TCGATTGGCT TGGCGGGCGA CCGCTGGGCA AGATGGGGCA
GTTGGCGCCG GATCTGGATG CCGAGGCCGT GGGCCGGATG ATCGGGGCGC AAATGGCGCG TATGCACGAC CTGTCGGACC
GCTGGACGCC GCCCGCGGGT TTCCAGCGCC CCGACTGGCG GCGTTCGGGT CTGCTGGGGG CGGACCCGCT CTGGGGTCGC
TTCTGGGAGC ATCCCGACCT CGACCCCGCG CAACGGCAGC TGATGATCGC GACCCGTGAG CGCGCGCTGG CGTGTTTCGA
GGATTTCGCG CCGGGGGCCG ATCAGGGCTT GATCCATGCC GATCTGGTCG TCGAGAATGT GCTGGTTGAC CACGATCGCG
TAGCGTTCAT AGATTTTGAC GACGGCGCCT GGGGGTATCG GGATTTCGAC CTTGCCACGG TTCTGGTCAA GTTCATCGGC
CAGCCTGATT ACGACAGGCT GCGGGCGGGC CTGTGCGCGG GCTATGACGC GCGCCGCAGG GTCGAGCCCG GCACGCTTGA
TTTCATGCTG CTGCTGCGGG CGCTGACCTA TCCGGGCTGG ATCATGTCAC GGCTGGACGA GCCGGGCGGG CGGCAAAGAT
CGGCGCGCAT GCTGGACACC GCGCTGCGGC TGGCCAGGGA TTTCATGGAG GAGAGGCAGA GATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7