Roseobase: Ruegeria pomeroyi DSS-3

Name: SPOA0356
Type: CDS
Description: identified by similarity to SP:Q8YDP7; match to protein family HMM PF06792
Source: Genbank
Position: CP000032.1:397884..399119 (+ strand)
Length: 1236
Dbxref: NCBI_GP:AAV97488.1
IMG: SPOA0356: hypothetical protein
Note: identified by similarity to SP:Q8YDP7; match to protein family HMM PF06792
RefSeq: SPO_RS21635: Tm-1-like ATP-binding domain-containing protein
gbkey: CDS
gene: SPOA0356
load_id: cds-AAV97488.1
locus_tag: SPOA0356
parent_id: gene-SPOA0356
product: hypothetical protein
protein_id: AAV97488.1
transl_table: 11
translation: MSDKTILIAGTYDTKDDELTYLAGVIAAQGGGVLSMDVSVLGDPSRPTDVSKHAVAEAGG SSIQAAIDSGDENGAMQIMARGAAAKALELYLAGRIHGVIVLGGTMGTDLALDLCAALPL GVPKYIVSTVSFSPLLPPERIPADVQMILWAGGLYGLNSICKASLSQAAGAVLGAARAVE APHRDRPLIGMTSFGKTVLRYMVSLKPALEARGYEVAVFHATGMGGRAFESLAAEGAFAA VFDFAPQEVANHLYGGLSAGADRMTNAGRRGIPQLVAPGCYDLVDYIGWQAPPPALADRP SHAHNRLLTSAVLEADERRAVARAICAKLAGASGPVALMLPTGGCNEWDRPDAPLHDAEG LAAFCDEIRSACPANADLVTLDAHINDAAFSERALAIFDDWVARGLVAKGA
>SPOA0356 class=Sequence position=CP000032.1:397884..399119 (+ strand)
ATGAGCGACA AGACGATCCT GATCGCGGGC ACCTATGACA CCAAGGATGA CGAGCTGACC TATCTTGCCG GTGTGATCGC
GGCGCAGGGG GGCGGCGTGC TGTCGATGGA TGTCAGCGTG CTGGGCGATC CGTCCCGGCC CACGGATGTC TCGAAACATG
CGGTGGCCGA GGCGGGTGGA AGCTCGATTC AGGCGGCCAT CGACAGTGGC GACGAGAATG GCGCCATGCA GATCATGGCC
CGGGGCGCGG CGGCCAAGGC GCTGGAGCTG TATCTTGCGG GGCGCATCCA TGGGGTGATC GTGCTGGGCG GCACCATGGG
CACCGATCTG GCGCTGGACC TGTGCGCCGC ATTGCCGCTT GGGGTGCCCA AATACATCGT CTCGACCGTG TCGTTCTCGC
CCCTGCTGCC GCCCGAGCGG ATCCCGGCGG ATGTGCAGAT GATCCTCTGG GCCGGAGGGC TTTACGGGCT GAATTCGATC
TGCAAGGCCT CGCTCAGCCA GGCGGCTGGG GCGGTGCTGG GGGCCGCGCG CGCGGTCGAG GCCCCGCATC GCGACCGGCC
GCTGATCGGC ATGACCAGCT TCGGCAAGAC GGTGCTGCGC TATATGGTCA GCCTGAAACC GGCGCTGGAG GCGCGCGGAT
ATGAGGTGGC GGTGTTCCAC GCGACCGGTA TGGGCGGGCG CGCGTTCGAG AGCTTGGCGG CCGAGGGCGC CTTTGCCGCC
GTGTTCGATT TCGCGCCGCA AGAGGTGGCC AACCACCTTT ATGGCGGTCT CTCGGCGGGG GCGGACCGGA TGACCAATGC
GGGCCGGCGG GGCATCCCGC AACTGGTGGC GCCGGGCTGT TACGATCTGG TCGATTACAT CGGCTGGCAG GCGCCGCCCC
CCGCGCTGGC CGACCGGCCC AGCCACGCCC ATAACCGCCT GTTGACCTCG GCGGTGCTGG AGGCGGACGA GCGCCGCGCC
GTCGCCCGCG CCATCTGCGC CAAGCTGGCC GGCGCAAGCG GCCCGGTGGC GCTGATGCTG CCCACCGGGG GTTGCAACGA
ATGGGACCGC CCGGACGCGC CGCTGCATGA TGCCGAGGGG CTGGCGGCCT TTTGCGACGA GATCCGCAGC GCCTGTCCGG
CCAATGCCGA CCTGGTCACG CTGGACGCCC ATATCAACGA CGCCGCGTTC TCCGAGCGGG CGCTGGCGAT CTTTGACGAT
TGGGTGGCGC GGGGGCTTGT GGCCAAGGGG GCGTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7