Roseobase: Ruegeria pomeroyi DSS-3

Name: ackA
Type: CDS
Description: identified by match to protein family HMM PF00871; match to protein family HMM TIGR00016
Source: Genbank
Position: CP000031.2:122521..123705 (+ strand)
Length: 1185
Dbxref: NCBI_GP:AAV93446.1
IMG: ackA: acetate kinase (EC 2.7.2.1)
Note: identified by match to protein family HMM PF00871; match to protein family HMM TIGR00016
RefSeq: SPO_RS00580: acetate/propionate family kinase
gbkey: CDS
gene: ackA
load_id: cds-AAV93446.1
locus_tag: SPO0116
parent_id: gene-SPO0116
product: acetate kinase
protein_id: AAV93446.1
transl_table: 11
translation: MTDVVLVLNAGSSSIKFAVYPSGTNTVPLIRGKVAGVGRDPVFSAVRADGTAIDMVMPKN IDAAADHEALISLLLDWLAEHRADRRLVAVGHRVVHGGRDFLKPVIVDDSVLSQLEQLIP LAPLHQPHNLAAIRAISRLQPTVPQVACFDTSFHQTQDRLAQLFALPRDLSDEGIIRYGF HGLSYEYIAGILPDHLGERAEGRVIVAHLGNGASMCAMKNRQSVATSMGFTALDGLMMGR RCGALDAGVVLYLMQSKGLNATEIETLLYRRCGLLGVSGISNNMRELERSDDPKAREAIE LFCFRAASVLGGLVTALGGLDAIVFTAGIGENSALVRKLICDRLACFGVDLDPNSNEGNS PRIGSVQSSIDVLVLPTDEEIVISNATNETVALG
>ackA class=Sequence position=CP000031.2:122521..123705 (+ strand)
ATGACGGACG TAGTACTGGT TCTCAATGCC GGTTCGTCGA GTATCAAGTT CGCCGTCTAC CCGAGTGGTA CGAACACGGT
TCCCCTGATC CGCGGCAAGG TGGCCGGTGT CGGACGTGAT CCCGTCTTCT CCGCAGTTCG CGCGGACGGT ACTGCAATCG
ACATGGTCAT GCCAAAGAAC ATCGACGCCG CAGCCGATCA TGAAGCGTTG ATATCACTCC TTCTGGATTG GCTGGCAGAG
CATCGCGCGG ACAGAAGACT TGTCGCCGTC GGGCACAGAG TCGTTCACGG TGGACGTGAT TTCCTCAAGC CGGTTATCGT
CGATGACTCA GTTCTGAGCC AGTTGGAACA ACTGATTCCG CTCGCACCGC TGCATCAGCC GCACAACCTT GCTGCCATCC
GCGCAATATC GCGGTTGCAG CCGACAGTAC CCCAGGTCGC CTGCTTCGAC ACGAGCTTTC ACCAGACCCA GGACCGGCTT
GCCCAACTAT TCGCCCTGCC TCGGGATCTG AGCGATGAAG GCATTATCCG CTATGGCTTT CACGGGCTGT CCTATGAGTA
TATCGCAGGA ATTCTGCCCG ATCATCTTGG CGAAAGGGCC GAGGGCCGGG TGATCGTTGC TCATCTCGGT AACGGCGCCA
GCATGTGCGC GATGAAGAAC CGGCAAAGTG TCGCGACAAG CATGGGGTTT ACGGCGCTTG ACGGGCTGAT GATGGGGCGG
CGCTGTGGCG CGCTCGACGC GGGCGTCGTT CTCTACCTCA TGCAAAGCAA GGGTCTGAAC GCGACCGAGA TCGAAACGCT
GCTCTATCGA CGCTGCGGCC TTCTCGGTGT CTCGGGGATC AGCAACAACA TGCGGGAGCT GGAACGGAGC GACGACCCGA
AGGCCCGCGA GGCGATCGAG CTATTCTGCT TCCGGGCGGC GAGCGTTCTT GGCGGCCTGG TCACGGCGCT TGGCGGGCTT
GACGCGATCG TTTTCACTGC AGGGATTGGA GAGAATTCGG CGCTGGTTCG CAAATTGATT TGTGACCGGC TTGCGTGTTT
TGGCGTCGAT CTGGATCCAA ACAGCAATGA AGGCAACTCG CCTCGCATTG GTTCGGTGCA ATCTTCTATT GACGTGCTTG
TTCTGCCGAC CGACGAAGAA ATCGTCATAT CCAATGCCAC GAACGAAACG GTCGCGCTCG GGTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7