Roseobase: Ruegeria pomeroyi DSS-3

Name: argG
Type: gene
Description:
Source: Genbank
Position: CP000031.2:17129..18358 (- strand)
Length: 1230
gbkey: Gene
gene: argG
gene_biotype: protein_coding
load_id: gene-SPO0018
locus_tag: SPO0018
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00764; match to protein family HMM TIGR00032
Source: Genbank
Position: CP000031.2:17129..18358 (- strand)
Length: 1230
Dbxref: NCBI_GP:AAV93349.1
IMG: argG: argininosuccinate synthase (EC 6.3.4.5)
Note: identified by match to protein family HMM PF00764; match to protein family HMM TIGR00032
RefSeq: SPO_RS00090: argininosuccinate synthase
gbkey: CDS
gene: argG
load_id: cds-AAV93349.1
locus_tag: SPO0018
parent_id: gene-SPO0018
product: argininosuccinate synthase
protein_id: AAV93349.1
transl_table: 11
translation: MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEELEPARKKAELLGIKPE NIHIEDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKRLVEIAAEHGADAVAHG ATGKGNDQVRFELSAYALNPEIRVIAPWRLWDLTSRTRLLEFAEAHQIPISKDKRGEAPF SVDANLLHTSSEGKVLEDPGVEAPDYVAQRIVAVEDAPDTPEFIEVTFEKGDAVAINGEA MSPATILTRLNELGGKHGIGLLDFVENRFVGMKSRGVYETPGGTILLEAHRGIEQITLDS GAGHLKDSIMPRYAELIYNGFWFSPEREMLQALIDKSQEHVTGTVRLKLYKGSARTVARW SDHSLYSEAHVTFEEDAGAYDQQDAKGFIQLNALRLKLLATRNRRVAGK
>argG class=Sequence position=CP000031.2:17129..18358 (- strand)
ATGTCCGCGC CCAAGAAAGT TGTCCTGGCC TATTCCGGTG GCCTCGATAC CTCGATCATC CTGAAATGGT TGCAGACCGA
ATATGGCTGC GAGGTTGTCA CCTTTACCGC CGATCTCGGC CAGGGAGAGG AGCTGGAACC CGCCCGCAAA AAGGCCGAGC
TGCTGGGCAT CAAGCCCGAG AACATCCATA TCGAGGATGT CCGCGAAGAG TTCGTGCGCG ACTTTGTCTT TCCGATGTTC
CGCGCCAATG CGGTGTACGA GGGGCTGTAT TTGCTGGGCA CTTCGATCGC GCGGCCGCTG ATCTCGAAAC GTCTGGTCGA
GATCGCCGCC GAACACGGCG CTGACGCGGT GGCCCATGGC GCCACCGGCA AGGGCAACGA CCAGGTGCGG TTCGAGCTTT
CCGCCTATGC GCTGAACCCC GAGATCAGGG TGATCGCGCC CTGGCGCCTG TGGGATCTGA CCAGCCGCAC CCGTCTGCTG
GAATTCGCCG AAGCGCATCA GATTCCGATT TCGAAGGACA AGCGCGGCGA GGCGCCGTTC TCGGTCGACG CGAACCTGCT
GCACACCTCG TCCGAGGGCA AGGTGCTGGA GGATCCGGGC GTCGAGGCGC CCGATTACGT CGCCCAACGC ATCGTCGCGG
TCGAAGACGC CCCCGACACG CCCGAGTTCA TCGAAGTTAC CTTTGAAAAG GGTGACGCGG TGGCGATCAA CGGCGAGGCG
ATGTCGCCCG CAACCATCCT GACCCGTCTG AACGAGTTGG GTGGCAAGCA CGGTATCGGC CTCTTGGATT TCGTCGAAAA
CCGCTTTGTC GGGATGAAAT CGCGCGGCGT CTACGAGACC CCCGGCGGGA CCATCCTGCT CGAGGCACAT CGCGGCATCG
AACAGATCAC GCTGGACAGC GGCGCGGGCC ACCTGAAGGA TTCGATCATG CCCCGCTATG CCGAGCTGAT CTATAACGGC
TTCTGGTTCA GCCCCGAGCG CGAGATGCTG CAGGCCCTGA TCGACAAGAG CCAGGAGCAC GTCACCGGCA CCGTCCGGCT
GAAACTCTAC AAGGGTTCGG CGCGCACCGT CGCCCGCTGG TCGGATCACT CGCTCTATTC CGAGGCCCAC GTGACCTTCG
AAGAGGACGC CGGCGCCTAT GACCAGCAGG ATGCCAAGGG CTTCATCCAG CTGAACGCGC TGCGGCTGAA ACTGCTTGCG
ACCCGCAACC GTCGCGTTGC TGGCAAGTGA 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7