Roseobase: Ruegeria pomeroyi DSS-3

Name: argG
Type: gene
Description:
Source: GenBank
Position: DSS3:17129..18358 (- strand)
Length: 1230
Dbxref: GeneID:3192922
load_id: SPO0018
locus_tag: SPO0018
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:17129..18358 (- strand)
Length: 1230
load_id: SPO0018.t01
parent_id: SPO0018
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00764; match to protein family HMM TIGR00032; NCBI:argininosuccinate synthase; IMG:argininosuccinate synthase
Source: GenBank
Position: DSS3:17129..18358 (- strand)
Length: 1230
Dbxref: GI:56694946
  GeneID:3192922
Note: identified by match to protein family HMM PF00764; match to protein family HMM TIGR00032
  NCBI:argininosuccinate synthase
  IMG:argininosuccinate synthase
codon_start: 1
eC_number: 6.3.4.5
load_id: SPO0018.p01
locus_tag: SPO0018
parent_id: SPO0018.t01
product: argininosuccinate synthase
protein_id: REF_tigr:SPO0018
  YP_165291.1
transl_table: 11
translation: MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEELEPARKKAELLGIKPE NIHIEDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKRLVEIAAEHGADAVAHG ATGKGNDQVRFELSAYALNPEIRVIAPWRLWDLTSRTRLLEFAEAHQIPISKDKRGEAPF SVDANLLHTSSEGKVLEDPGVEAPDYVAQRIVAVEDAPDTPEFIEVTFEKGDAVAINGEA MSPATILTRLNELGGKHGIGLLDFVENRFVGMKSRGVYETPGGTILLEAHRGIEQITLDS GAGHLKDSIMPRYAELIYNGFWFSPEREMLQALIDKSQEHVTGTVRLKLYKGSARTVARW SDHSLYSEAHVTFEEDAGAYDQQDAKGFIQLNALRLKLLATRNRRVAGK
Type: exon
Description:
Source: GenBank
Position: DSS3:17129..18358 (- strand)
Length: 1230
parent_id: SPO0018.t01
> class=Sequence position=DSS3:17129..18358 (- strand)
ATGTCCGCGC CCAAGAAAGT TGTCCTGGCC TATTCCGGTG GCCTCGATAC CTCGATCATC CTGAAATGGT TGCAGACCGA
ATATGGCTGC GAGGTTGTCA CCTTTACCGC CGATCTCGGC CAGGGAGAGG AGCTGGAACC CGCCCGCAAA AAGGCCGAGC
TGCTGGGCAT CAAGCCCGAG AACATCCATA TCGAGGATGT CCGCGAAGAG TTCGTGCGCG ACTTTGTCTT TCCGATGTTC
CGCGCCAATG CGGTGTACGA GGGGCTGTAT TTGCTGGGCA CTTCGATCGC GCGGCCGCTG ATCTCGAAAC GTCTGGTCGA
GATCGCCGCC GAACACGGCG CTGACGCGGT GGCCCATGGC GCCACCGGCA AGGGCAACGA CCAGGTGCGG TTCGAGCTTT
CCGCCTATGC GCTGAACCCC GAGATCAGGG TGATCGCGCC CTGGCGCCTG TGGGATCTGA CCAGCCGCAC CCGTCTGCTG
GAATTCGCCG AAGCGCATCA GATTCCGATT TCGAAGGACA AGCGCGGCGA GGCGCCGTTC TCGGTCGACG CGAACCTGCT
GCACACCTCG TCCGAGGGCA AGGTGCTGGA GGATCCGGGC GTCGAGGCGC CCGATTACGT CGCCCAACGC ATCGTCGCGG
TCGAAGACGC CCCCGACACG CCCGAGTTCA TCGAAGTTAC CTTTGAAAAG GGTGACGCGG TGGCGATCAA CGGCGAGGCG
ATGTCGCCCG CAACCATCCT GACCCGTCTG AACGAGTTGG GTGGCAAGCA CGGTATCGGC CTCTTGGATT TCGTCGAAAA
CCGCTTTGTC GGGATGAAAT CGCGCGGCGT CTACGAGACC CCCGGCGGGA CCATCCTGCT CGAGGCACAT CGCGGCATCG
AACAGATCAC GCTGGACAGC GGCGCGGGCC ACCTGAAGGA TTCGATCATG CCCCGCTATG CCGAGCTGAT CTATAACGGC
TTCTGGTTCA GCCCCGAGCG CGAGATGCTG CAGGCCCTGA TCGACAAGAG CCAGGAGCAC GTCACCGGCA CCGTCCGGCT
GAAACTCTAC AAGGGTTCGG CGCGCACCGT CGCCCGCTGG TCGGATCACT CGCTCTATTC CGAGGCCCAC GTGACCTTCG
AAGAGGACGC CGGCGCCTAT GACCAGCAGG ATGCCAAGGG CTTCATCCAG CTGAACGCGC TGCGGCTGAA ACTGCTTGCG
ACCCGCAACC GTCGCGTTGC TGGCAAGTGA 
>argG class=Sequence position=DSS3:17129..18358 (- strand)
ATGTCCGCGC CCAAGAAAGT TGTCCTGGCC TATTCCGGTG GCCTCGATAC CTCGATCATC CTGAAATGGT TGCAGACCGA
ATATGGCTGC GAGGTTGTCA CCTTTACCGC CGATCTCGGC CAGGGAGAGG AGCTGGAACC CGCCCGCAAA AAGGCCGAGC
TGCTGGGCAT CAAGCCCGAG AACATCCATA TCGAGGATGT CCGCGAAGAG TTCGTGCGCG ACTTTGTCTT TCCGATGTTC
CGCGCCAATG CGGTGTACGA GGGGCTGTAT TTGCTGGGCA CTTCGATCGC GCGGCCGCTG ATCTCGAAAC GTCTGGTCGA
GATCGCCGCC GAACACGGCG CTGACGCGGT GGCCCATGGC GCCACCGGCA AGGGCAACGA CCAGGTGCGG TTCGAGCTTT
CCGCCTATGC GCTGAACCCC GAGATCAGGG TGATCGCGCC CTGGCGCCTG TGGGATCTGA CCAGCCGCAC CCGTCTGCTG
GAATTCGCCG AAGCGCATCA GATTCCGATT TCGAAGGACA AGCGCGGCGA GGCGCCGTTC TCGGTCGACG CGAACCTGCT
GCACACCTCG TCCGAGGGCA AGGTGCTGGA GGATCCGGGC GTCGAGGCGC CCGATTACGT CGCCCAACGC ATCGTCGCGG
TCGAAGACGC CCCCGACACG CCCGAGTTCA TCGAAGTTAC CTTTGAAAAG GGTGACGCGG TGGCGATCAA CGGCGAGGCG
ATGTCGCCCG CAACCATCCT GACCCGTCTG AACGAGTTGG GTGGCAAGCA CGGTATCGGC CTCTTGGATT TCGTCGAAAA
CCGCTTTGTC GGGATGAAAT CGCGCGGCGT CTACGAGACC CCCGGCGGGA CCATCCTGCT CGAGGCACAT CGCGGCATCG
AACAGATCAC GCTGGACAGC GGCGCGGGCC ACCTGAAGGA TTCGATCATG CCCCGCTATG CCGAGCTGAT CTATAACGGC
TTCTGGTTCA GCCCCGAGCG CGAGATGCTG CAGGCCCTGA TCGACAAGAG CCAGGAGCAC GTCACCGGCA CCGTCCGGCT
GAAACTCTAC AAGGGTTCGG CGCGCACCGT CGCCCGCTGG TCGGATCACT CGCTCTATTC CGAGGCCCAC GTGACCTTCG
AAGAGGACGC CGGCGCCTAT GACCAGCAGG ATGCCAAGGG CTTCATCCAG CTGAACGCGC TGCGGCTGAA ACTGCTTGCG
ACCCGCAACC GTCGCGTTGC TGGCAAGTGA 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7