Roseobase: Ruegeria pomeroyi DSS-3

Name: argJ
Type: CDS
Description: identified by similarity to SP:P38434; match to protein family HMM PF01960; match to protein family HMM TIGR00120; NCBI:arginine biosynthesis bifunctional protein ArgJ; IMG:glutamate N-acetyltransferase
Source: GenBank
Position: DSS3:60750..61976 (+ strand)
Length: 1227
Dbxref: GI:56694987
  GeneID:3193952
Note: identified by similarity to SP:P38434; match to protein family HMM PF01960; match to protein family HMM TIGR00120
  NCBI:arginine biosynthesis bifunctional protein ArgJ
  IMG:glutamate N-acetyltransferase
codon_start: 1
eC_number: 2.3.1.35
  2.3.1.1
load_id: SPO0059.p01
locus_tag: SPO0059
parent_id: SPO0059.t01
product: glutamate N-acetyltransferase/amino-acid acetyltransferase
protein_id: REF_tigr:SPO0059
  YP_165333.1
transl_table: 11
translation: MAKITKVSPLAPAAFPTLPVIDGVRLASIAAGVRYQGRTDVMLAVLDPGTSVAGVFTRSA TRSAPVLDCQAKIGGASDGPAAILVNSGNSNAFTGHYGQTSVAEVTQAVADVTGVPVGRV FTSSTGVIGEPMKHERIVAKLGDLNAALSPDALEDAARAIMTTDTFAKGASRTVGIDGKM VKIAGIAKGSGMIAPDMATMLVYIFTDARVEQGALQAMLSAMTDKTFNCITVDSDTSTSD TLLLCATGASGVDAEGNAEFAAALEAVMLDLAQQVVRDGEGATKFVEIRVTGAANDVDAK VHGLAIANSPLVKTAIAGEDPNWGRVVMAIGKSGAAADRDLLSISFGDILVAEKGWVSPN YREEDAAAYMKGQDLVIGVDLGLGAGKSTVWTCDLTHGYIEINADYRS
>argJ class=Sequence position=DSS3:60750..61976 (+ strand)
ATGGCGAAGA TCACCAAGGT TTCCCCTCTG GCGCCTGCGG CGTTTCCGAC GCTGCCGGTC ATCGACGGCG TGCGGCTGGC
CAGCATCGCG GCGGGTGTGC GCTATCAGGG TCGCACCGAT GTGATGCTGG CGGTGCTTGA CCCCGGCACT TCGGTCGCGG
GTGTGTTCAC CCGCTCGGCC ACCCGGTCGG CGCCGGTGCT GGACTGTCAG GCCAAGATCG GCGGCGCCAG CGACGGGCCC
GCCGCGATCC TGGTCAACTC GGGAAATTCC AACGCCTTTA CCGGCCATTA CGGCCAGACT TCGGTGGCCG AGGTTACACA
GGCGGTGGCG GATGTGACCG GGGTTCCGGT CGGGCGGGTC TTTACCTCGT CCACCGGGGT GATCGGCGAG CCGATGAAAC
ACGAGCGTAT CGTTGCCAAG CTGGGCGATC TGAACGCGGC GCTCAGCCCC GACGCGCTGG AAGACGCCGC CCGCGCCATC
ATGACCACCG ATACCTTTGC CAAGGGTGCC AGCCGGACCG TCGGGATCGA CGGCAAGATG GTCAAGATCG CGGGCATCGC
CAAGGGTTCG GGCATGATCG CGCCCGACAT GGCGACGATG CTGGTTTACA TCTTTACCGA CGCCCGCGTC GAACAGGGCG
CGTTGCAGGC GATGCTGTCG GCAATGACCG ACAAAACCTT CAACTGCATC ACCGTGGACA GCGATACCTC GACCTCGGAC
ACGCTGCTCT TGTGCGCGAC CGGTGCCTCG GGCGTGGACG CAGAGGGCAA TGCCGAATTT GCCGCCGCGC TTGAGGCGGT
GATGCTGGAC CTGGCCCAGC AGGTGGTACG TGATGGCGAA GGCGCGACCA AATTCGTCGA GATCCGGGTC ACCGGCGCGG
CCAACGATGT CGACGCCAAG GTGCACGGGC TGGCGATTGC CAATTCACCG CTGGTCAAGA CCGCGATCGC GGGCGAGGAC
CCGAACTGGG GTCGGGTGGT GATGGCGATC GGCAAATCCG GCGCCGCTGC GGACCGTGAT CTGCTGAGCA TCTCGTTCGG
CGATATCCTG GTGGCGGAAA AGGGTTGGGT CAGCCCCAAC TATCGCGAAG AGGACGCCGC TGCCTATATG AAGGGTCAGG
ATCTTGTGAT CGGCGTCGAT CTGGGCCTGG GCGCAGGCAA GTCCACCGTC TGGACCTGTG ATCTGACCCA TGGCTATATC
GAGATCAACG CGGATTACCG GTCGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7