Roseobase: Ruegeria pomeroyi DSS-3

Name: betB
Type: gene
Description:
Source: GenBank
Position: DSS3:82247..83701 (- strand)
Length: 1455
Dbxref: GeneID:3194160
load_id: SPO0084
locus_tag: SPO0084
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:82247..83701 (- strand)
Length: 1455
load_id: SPO0084.t01
parent_id: SPO0084
Parts:
Type: CDS
Description: identified by similarity to SP:P54222; match to protein family HMM PF00171; match to protein family HMM TIGR01804; NCBI:betaine-aldehyde dehydrogenase; IMG:betaine aldehyde dehydrogenase
Source: GenBank
Position: DSS3:82247..83701 (- strand)
Length: 1455
Dbxref: GI:56695012
  GeneID:3194160
Note: identified by similarity to SP:P54222; match to protein family HMM PF00171; match to protein family HMM TIGR01804
  NCBI:betaine-aldehyde dehydrogenase
  IMG:betaine aldehyde dehydrogenase
codon_start: 1
eC_number: 1.2.1.8
load_id: SPO0084.p01
locus_tag: SPO0084
parent_id: SPO0084.t01
product: betaine aldehyde dehydrogenase
protein_id: REF_tigr:SPO0084
  YP_165358.1
transl_table: 11
translation: MKFQPEASHFINGAYVEDTAGAVIDVIYPATGEVIARLHSATPAIIDQALEAARQAQAQW AAMTGTERGRILRRAADIMRARNHDLSVIETHDTGKPIQETTVADATSGADALEYFGGLA GSLTGEHIPLGGGDFAYTVREALGVCVGIGAWNYPTQIACWKGAPALACGNTMVFKPSET TPLSALKVAEILIEAGAPKGIYNVVQGYGDVGASLVTDPRVAKVSLTGSVPTGRRVYAAA AESIKHVTMELGGKSPLVVFDDADIENAVSGAILGNFYSSGQVCSNGTRVFVQKGIKEAF LSRLAERLATAVIGDPMDPATNFGPMVSEAQMNIVLGYVDKGKAEGARLVYGGTRLDRDG FYLLPTVFADVTDDMTIAREEIFGPVMSVLDFDTEEEVLERANATEFGLAAGVFTRDITR AHRMVAGFEAGTCYINSYNLAPVEAPFGGSKQSGVGRENSKLAINHFSEMKTVFVSMNDI QAPY
Type: exon
Description:
Source: GenBank
Position: DSS3:82247..83701 (- strand)
Length: 1455
parent_id: SPO0084.t01
> class=Sequence position=DSS3:82247..83701 (- strand)
ATGAAGTTCC AGCCAGAAGC GAGCCATTTC ATCAATGGCG CCTATGTCGA GGACACGGCA GGCGCCGTGA TCGACGTGAT
CTATCCCGCC ACCGGCGAAG TGATCGCCCG GTTGCACTCG GCCACACCCG CGATCATCGA TCAGGCGCTC GAGGCCGCGC
GGCAGGCGCA GGCGCAATGG GCCGCGATGA CCGGGACCGA ACGTGGCCGC ATCCTGCGCC GCGCCGCCGA CATCATGCGC
GCCCGCAACC ACGACCTGTC GGTGATCGAG ACCCATGACA CCGGCAAACC CATTCAGGAA ACCACCGTTG CCGATGCCAC
CTCGGGCGCC GATGCGCTGG AGTACTTCGG CGGGCTGGCC GGGTCGCTGA CCGGCGAGCA TATCCCGCTG GGCGGCGGTG
ATTTCGCCTA TACCGTCCGT GAGGCGCTGG GCGTCTGCGT CGGCATCGGC GCCTGGAACT ATCCCACCCA GATCGCCTGC
TGGAAGGGCG CCCCGGCGCT GGCCTGCGGC AATACGATGG TGTTCAAGCC ATCGGAAACC ACCCCTCTTT CCGCCCTCAA
GGTCGCCGAG ATCCTGATCG AGGCCGGGGC GCCCAAGGGT ATCTATAACG TTGTGCAGGG CTATGGCGAT GTCGGCGCGT
CCCTGGTCAC CGATCCGCGC GTCGCCAAGG TGTCGCTCAC CGGTTCGGTC CCCACCGGGC GCCGGGTCTA TGCCGCCGCC
GCCGAAAGCA TCAAGCACGT GACGATGGAA CTGGGCGGCA AGTCGCCCTT GGTCGTGTTT GACGACGCCG ATATCGAAAA
CGCGGTCTCG GGCGCCATTC TGGGCAACTT CTATTCCTCG GGTCAGGTCT GCTCGAACGG GACCCGCGTG TTTGTGCAGA
AGGGCATCAA GGAGGCGTTC CTGTCCCGCC TGGCCGAGCG TCTGGCAACG GCGGTGATCG GCGACCCGAT GGACCCGGCC
ACCAATTTCG GGCCGATGGT CAGCGAGGCG CAGATGAACA TCGTCCTGGG ATATGTCGAC AAGGGCAAGG CCGAGGGCGC
CCGGCTGGTC TATGGCGGCA CCCGGCTGGA TCGCGACGGG TTCTACCTGC TGCCCACCGT GTTTGCCGAT GTGACCGATG
ACATGACCAT CGCGCGGGAA GAGATTTTCG GCCCGGTCAT GTCGGTACTC GACTTCGACA CCGAGGAAGA GGTGTTGGAG
CGCGCCAATG CCACCGAATT CGGCCTCGCC GCGGGCGTCT TTACCCGCGA CATTACCCGC GCCCATCGGA TGGTGGCCGG
GTTCGAAGCG GGCACCTGCT ATATCAACAG CTATAACCTG GCCCCGGTCG AGGCGCCCTT TGGCGGTTCG AAACAGTCGG
GCGTGGGCCG CGAAAACTCG AAACTGGCGA TCAACCACTT CTCCGAGATG AAAACAGTGT TTGTCTCGAT GAACGATATC
CAGGCGCCCT ACTGA
>betB class=Sequence position=DSS3:82247..83701 (- strand)
ATGAAGTTCC AGCCAGAAGC GAGCCATTTC ATCAATGGCG CCTATGTCGA GGACACGGCA GGCGCCGTGA TCGACGTGAT
CTATCCCGCC ACCGGCGAAG TGATCGCCCG GTTGCACTCG GCCACACCCG CGATCATCGA TCAGGCGCTC GAGGCCGCGC
GGCAGGCGCA GGCGCAATGG GCCGCGATGA CCGGGACCGA ACGTGGCCGC ATCCTGCGCC GCGCCGCCGA CATCATGCGC
GCCCGCAACC ACGACCTGTC GGTGATCGAG ACCCATGACA CCGGCAAACC CATTCAGGAA ACCACCGTTG CCGATGCCAC
CTCGGGCGCC GATGCGCTGG AGTACTTCGG CGGGCTGGCC GGGTCGCTGA CCGGCGAGCA TATCCCGCTG GGCGGCGGTG
ATTTCGCCTA TACCGTCCGT GAGGCGCTGG GCGTCTGCGT CGGCATCGGC GCCTGGAACT ATCCCACCCA GATCGCCTGC
TGGAAGGGCG CCCCGGCGCT GGCCTGCGGC AATACGATGG TGTTCAAGCC ATCGGAAACC ACCCCTCTTT CCGCCCTCAA
GGTCGCCGAG ATCCTGATCG AGGCCGGGGC GCCCAAGGGT ATCTATAACG TTGTGCAGGG CTATGGCGAT GTCGGCGCGT
CCCTGGTCAC CGATCCGCGC GTCGCCAAGG TGTCGCTCAC CGGTTCGGTC CCCACCGGGC GCCGGGTCTA TGCCGCCGCC
GCCGAAAGCA TCAAGCACGT GACGATGGAA CTGGGCGGCA AGTCGCCCTT GGTCGTGTTT GACGACGCCG ATATCGAAAA
CGCGGTCTCG GGCGCCATTC TGGGCAACTT CTATTCCTCG GGTCAGGTCT GCTCGAACGG GACCCGCGTG TTTGTGCAGA
AGGGCATCAA GGAGGCGTTC CTGTCCCGCC TGGCCGAGCG TCTGGCAACG GCGGTGATCG GCGACCCGAT GGACCCGGCC
ACCAATTTCG GGCCGATGGT CAGCGAGGCG CAGATGAACA TCGTCCTGGG ATATGTCGAC AAGGGCAAGG CCGAGGGCGC
CCGGCTGGTC TATGGCGGCA CCCGGCTGGA TCGCGACGGG TTCTACCTGC TGCCCACCGT GTTTGCCGAT GTGACCGATG
ACATGACCAT CGCGCGGGAA GAGATTTTCG GCCCGGTCAT GTCGGTACTC GACTTCGACA CCGAGGAAGA GGTGTTGGAG
CGCGCCAATG CCACCGAATT CGGCCTCGCC GCGGGCGTCT TTACCCGCGA CATTACCCGC GCCCATCGGA TGGTGGCCGG
GTTCGAAGCG GGCACCTGCT ATATCAACAG CTATAACCTG GCCCCGGTCG AGGCGCCCTT TGGCGGTTCG AAACAGTCGG
GCGTGGGCCG CGAAAACTCG AAACTGGCGA TCAACCACTT CTCCGAGATG AAAACAGTGT TTGTCTCGAT GAACGATATC
CAGGCGCCCT ACTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7