Roseobase: Ruegeria pomeroyi DSS-3

Name: bktB
Type: CDS
Description: identified by similarity to GB:AAC38322.1; match to protein family HMM PF00108; match to protein family HMM PF02803; match to protein family HMM TIGR01930
Source: Genbank
Position: CP000031.2:156963..158138 (+ strand)
Length: 1176
Dbxref: NCBI_GP:AAV93470.1
IMG: bktB: beta-ketothiolase
Note: identified by similarity to GB:AAC38322.1; match to protein family HMM PF00108; match to protein family HMM PF02803; match to protein family HMM TIGR01930
RefSeq: SPO_RS00730: acetyl-CoA C-acyltransferase family protein
gbkey: CDS
gene: bktB
load_id: cds-AAV93470.1
locus_tag: SPO0142
parent_id: gene-SPO0142
product: beta-ketothiolase
protein_id: AAV93470.1
transl_table: 11
translation: MTDIVILDGARTAIGTFGGALASTAPIDLATVVTEAALERSGVEGGQIGHVVFGHVINTE PRDMYLSRVAAMQAGIPNGTPAMNVNRLCGSGAQAIVSAVQSLMLGDAEFAVAGGAESMS RSPFIMTQARWGAKMGDVKSLDMMLGALNCPFGTGHMGVTAENVADEHQISREQMDQFAM TSQERAAAAIAAGHFDGQITPVQVKVKRDMVDFKVDEHPKATSVEVLAGLKPVFKKDGRV TAGNASGINDGAAAMVLATADAAEKAGLKPKARILGYAHAGVRPEVMGIGPVPAVQNLLA RTGLSIGDFDVIESNEAFAAQALAVNKELGLDAAKVNPNGGAIALGHPVGATGAIITLKT LYELERTGGSKGLITMCIGGGQGIAIAIELL
>bktB class=Sequence position=CP000031.2:156963..158138 (+ strand)
ATGACCGATA TCGTGATTCT GGACGGTGCC CGCACCGCCA TAGGCACTTT TGGCGGGGCG CTGGCCTCGA CCGCGCCCAT
CGACCTGGCC ACCGTGGTGA CCGAGGCGGC GCTGGAACGT TCGGGCGTCG AAGGCGGCCA GATCGGCCAT GTGGTGTTCG
GCCATGTGAT CAATACCGAA CCCCGCGACA TGTATCTGAG CCGCGTTGCC GCCATGCAGG CGGGCATCCC GAACGGCACC
CCCGCGATGA ACGTGAACCG CCTGTGCGGC TCGGGTGCGC AGGCCATCGT CTCGGCGGTG CAATCGCTGA TGCTGGGGGA
TGCCGAATTC GCGGTGGCCG GTGGTGCCGA AAGCATGTCG CGCAGCCCGT TCATCATGAC CCAGGCCCGC TGGGGCGCCA
AGATGGGCGA TGTCAAATCG CTCGACATGA TGCTGGGCGC GTTGAATTGC CCGTTTGGCA CCGGGCACAT GGGTGTGACC
GCCGAAAATG TCGCCGACGA GCACCAGATC AGCCGTGAAC AGATGGACCA GTTCGCCATG ACCTCGCAGG AACGCGCGGC
GGCGGCCATC GCGGCGGGGC ACTTCGACGG CCAGATCACG CCCGTACAGG TCAAGGTCAA GCGCGACATG GTCGATTTCA
AGGTCGACGA GCACCCCAAG GCAACCTCGG TCGAGGTACT GGCCGGGCTG AAGCCGGTGT TCAAGAAGGA TGGCCGGGTG
ACAGCAGGTA ACGCCAGCGG CATCAACGAT GGTGCGGCGG CGATGGTGCT GGCCACGGCG GATGCGGCCG AAAAGGCCGG
GCTGAAGCCC AAGGCGCGCA TTCTGGGTTA TGCCCATGCC GGCGTGCGCC CCGAGGTGAT GGGGATCGGC CCGGTTCCCG
CGGTGCAGAA TCTGTTGGCG CGTACCGGGC TGAGCATCGG CGATTTCGAC GTGATCGAAA GCAACGAGGC CTTTGCCGCG
CAGGCACTGG CGGTGAACAA GGAGCTGGGC CTGGATGCGG CCAAGGTGAA TCCCAATGGC GGCGCGATTG CCCTTGGCCA
CCCGGTCGGC GCAACCGGTG CGATCATCAC GCTGAAAACG CTTTATGAAC TGGAGCGCAC CGGCGGATCC AAGGGTCTGA
TCACCATGTG CATCGGTGGC GGACAGGGCA TCGCCATCGC CATCGAGCTG CTCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7