Roseobase: Ruegeria pomeroyi DSS-3

Name: cysQ
Type: gene
Description:
Source: GenBank
Position: DSS3:39567..40364 (- strand)
Length: 798
Dbxref: GeneID:3194237
load_id: SPO0039
locus_tag: SPO0039
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:39567..40364 (- strand)
Length: 798
load_id: SPO0039.t01
parent_id: SPO0039
Parts:
Type: CDS
Description: identified by similarity to SP:P22255; match to protein family HMM PF00459; match to protein family HMM TIGR01331; NCBI:3'(2'); 5'-bisphosphate nucleotidase CysQ; IMG:3'(2'); 5'-bisphosphate nucleotidase
Source: GenBank
Position: DSS3:39567..40364 (- strand)
Length: 798
Dbxref: GI:56694967
  GeneID:3194237
Note: identified by similarity to SP:P22255; match to protein family HMM PF00459; match to protein family HMM TIGR01331
  NCBI:3'(2')
  5'-bisphosphate nucleotidase CysQ
  IMG:3'(2')
  5'-bisphosphate nucleotidase
codon_start: 1
eC_number: 3.1.3.7
load_id: SPO0039.p01
locus_tag: SPO0039
parent_id: SPO0039.t01
product: 3'(2'),5'-bisphosphate nucleotidase
protein_id: REF_tigr:SPO0039
  YP_165312.1
transl_table: 11
translation: MTYEELIPVIRRLALEAGDVIMSIYNADDFGVKVKSDSSPVTEADEAADALISAGLRAAF PDILLVTEEQAASHSQTGDTFLIVDPLDGTKEFINRRGDFTVNIALVENGTPTRGVVYAP AKGRMFYTLADGSSVEETGGLDKETPGDLSPIRVAEADNAALLVVASKSHRDQATEDYIG KYAVKDSKSAGSSLKFCLVATGEADLYPRVGRTMEWDTAAGHAVLAGAGGKVVRFDNHQP LTYGKDGYANPFFIAYAPSVTLKEA
Type: exon
Description:
Source: GenBank
Position: DSS3:39567..40364 (- strand)
Length: 798
parent_id: SPO0039.t01
> class=Sequence position=DSS3:39567..40364 (- strand)
GTGACCTACG AGGAACTAAT TCCCGTCATT CGCCGTCTCG CGCTTGAGGC GGGCGATGTG ATCATGTCCA TCTACAACGC
CGACGATTTC GGCGTGAAGG TCAAATCGGA CTCCAGCCCG GTGACCGAGG CGGACGAGGC AGCCGACGCG CTGATCTCGG
CGGGCTTGCG CGCGGCCTTC CCCGATATCC TGCTGGTGAC CGAGGAACAG GCGGCCTCGC ACAGCCAGAC GGGCGACACC
TTCCTGATCG TCGATCCGCT GGACGGGACC AAGGAATTCA TCAACCGGCG CGGCGATTTC ACCGTCAATA TCGCGCTGGT
GGAAAACGGC ACGCCCACGC GTGGCGTGGT CTATGCCCCG GCCAAGGGAC GGATGTTCTA TACTCTGGCG GATGGCAGCT
CGGTCGAGGA GACCGGCGGA CTGGACAAGG AAACGCCCGG TGACCTCTCT CCGATCCGGG TGGCCGAGGC CGACAATGCC
GCGCTGCTGG TGGTGGCGTC GAAATCGCAC CGCGACCAGG CGACCGAGGA TTACATCGGC AAATACGCCG TCAAGGACAG
CAAGAGCGCC GGATCCTCGC TGAAATTCTG TCTGGTGGCC ACGGGCGAGG CCGATCTTTA CCCGCGTGTT GGCCGTACCA
TGGAATGGGA CACTGCCGCC GGTCACGCGG TTCTGGCCGG AGCCGGGGGC AAGGTGGTAC GTTTCGACAA TCACCAGCCG
CTGACCTATG GCAAGGACGG CTATGCCAAC CCGTTCTTCA TCGCCTACGC CCCCAGCGTC ACCCTCAAGG AAGCCTGA
>cysQ class=Sequence position=DSS3:39567..40364 (- strand)
GTGACCTACG AGGAACTAAT TCCCGTCATT CGCCGTCTCG CGCTTGAGGC GGGCGATGTG ATCATGTCCA TCTACAACGC
CGACGATTTC GGCGTGAAGG TCAAATCGGA CTCCAGCCCG GTGACCGAGG CGGACGAGGC AGCCGACGCG CTGATCTCGG
CGGGCTTGCG CGCGGCCTTC CCCGATATCC TGCTGGTGAC CGAGGAACAG GCGGCCTCGC ACAGCCAGAC GGGCGACACC
TTCCTGATCG TCGATCCGCT GGACGGGACC AAGGAATTCA TCAACCGGCG CGGCGATTTC ACCGTCAATA TCGCGCTGGT
GGAAAACGGC ACGCCCACGC GTGGCGTGGT CTATGCCCCG GCCAAGGGAC GGATGTTCTA TACTCTGGCG GATGGCAGCT
CGGTCGAGGA GACCGGCGGA CTGGACAAGG AAACGCCCGG TGACCTCTCT CCGATCCGGG TGGCCGAGGC CGACAATGCC
GCGCTGCTGG TGGTGGCGTC GAAATCGCAC CGCGACCAGG CGACCGAGGA TTACATCGGC AAATACGCCG TCAAGGACAG
CAAGAGCGCC GGATCCTCGC TGAAATTCTG TCTGGTGGCC ACGGGCGAGG CCGATCTTTA CCCGCGTGTT GGCCGTACCA
TGGAATGGGA CACTGCCGCC GGTCACGCGG TTCTGGCCGG AGCCGGGGGC AAGGTGGTAC GTTTCGACAA TCACCAGCCG
CTGACCTATG GCAAGGACGG CTATGCCAAC CCGTTCTTCA TCGCCTACGC CCCCAGCGTC ACCCTCAAGG AAGCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7