Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO3780
Type: gene
Description:
Source: Genbank
Position: CP000031.2:3992599..3993726 (+ strand)
Length: 1128
gbkey: Gene
gene: SPO3780
gene_biotype: protein_coding
load_id: gene-SPO3780
locus_tag: SPO3780
Parts:
Type: CDS
Description: identified by match to protein family HMM PF03739
Source: Genbank
Position: CP000031.2:3992599..3993726 (+ strand)
Length: 1128
Dbxref: NCBI_GP:AAV97000.1
IMG: SPO3780: lipopolysaccharide export system permease protein
Note: identified by match to protein family HMM PF03739
RefSeq: SPO_RS19185: lptF: LPS export ABC transporter permease LptF
gbkey: CDS
gene: SPO3780
load_id: cds-AAV97000.1
locus_tag: SPO3780
parent_id: gene-SPO3780
product: hypothetical protein
protein_id: AAV97000.1
transl_table: 11
translation: MSKFDGYFLRQLLVLCGFFAFVLVGVFWISKAVSLFDRLISSGQTAMVALEFTALTLPTL VRTVMPMAAFCATVYVTNRLNRESEMTVMLATGSSPFRLARPVILFGLVCAAMLATITLY LRPAAMLRLEARQAEVAGDMTAQLLNDGQFMHPVKGVTVYIGKIDRDGTLNDVYLSDRRA PERVVTYTSSKAFLARSGEQIALVMVEGTALQMETGRRTLSTTVFRDFSYDISALAKRDI ERRQDIRGMPTLALATAFDGEGLAETYSRGEISEELQERLSWIGVSVAVTLIGFSTLMLG TFSRFGLWPQLIAAFAGLIALEGMRSTATAFVGSHPGLWWVQHAPALGGIALSILFLKLA GRPLRLRRYPDTGSV
>SPO3780 class=Sequence position=CP000031.2:3992599..3993726 (+ strand)
ATGTCAAAGT TCGATGGATA TTTCCTGCGC CAATTGCTGG TTCTCTGCGG CTTCTTCGCC TTTGTTCTGG TCGGCGTCTT
CTGGATCAGC AAGGCGGTCA GCCTGTTCGA CAGGCTGATC AGCAGCGGAC AGACGGCGAT GGTAGCGCTG GAGTTCACCG
CGCTGACACT GCCGACGCTG GTGCGCACCG TGATGCCGAT GGCGGCATTC TGCGCAACGG TCTATGTCAC CAACCGCCTG
AACCGCGAAA GCGAGATGAC GGTAATGCTG GCCACCGGCA GCAGCCCGTT CCGCCTGGCC CGCCCGGTCA TCCTGTTTGG
CCTGGTCTGC GCGGCGATGC TGGCCACGAT CACGCTTTAT CTGCGGCCCG CCGCCATGTT GCGGCTCGAG GCGCGTCAGG
CCGAAGTGGC AGGAGACATG ACCGCGCAAC TTCTCAACGA CGGGCAGTTC ATGCACCCGG TCAAGGGTGT GACCGTCTAT
ATCGGCAAGA TCGACCGCGA CGGTACGCTG AACGATGTTT ACCTGTCGGA CCGGCGTGCG CCCGAGCGCG TGGTGACCTA
TACCAGTTCC AAGGCGTTTC TGGCCCGCAG CGGCGAGCAG ATCGCGCTGG TGATGGTCGA AGGCACCGCC CTGCAGATGG
AGACCGGGCG CAGAACCCTG TCGACCACCG TGTTCCGCGA CTTCTCCTAT GACATTTCGG CGCTGGCCAA GCGGGATATC
GAACGGCGAC AGGATATTCG GGGCATGCCG ACGCTGGCCC TCGCAACAGC CTTTGACGGC GAGGGCCTGG CCGAGACCTA
TTCCCGAGGC GAGATTTCCG AAGAGCTGCA GGAGCGCCTG TCTTGGATCG GTGTCAGTGT TGCTGTCACC CTGATCGGGT
TTTCGACTCT GATGCTGGGC ACGTTCTCCC GCTTTGGCCT CTGGCCGCAA CTGATCGCCG CCTTTGCCGG GCTGATTGCG
CTTGAAGGGA TGCGCAGCAC CGCCACGGCC TTTGTCGGAT CGCATCCCGG GCTGTGGTGG GTCCAGCACG CACCCGCCCT
GGGCGGTATC GCGCTATCGA TCCTGTTCCT CAAGCTCGCA GGCCGACCGT TGCGCCTGCG CCGGTATCCA GACACCGGCA
GCGTTTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7