Roseobase: Ruegeria pomeroyi DSS-3

Name: dmdA
Type: CDS
Description: dimethyl sulfoniopropionate (DMSP) demethylase; identified by match to protein family HMM PF01571; NCBI:dimethylsulfonioproprionate demethylase DmdA; IMG:dimethylsulfoniopropionate demethylase
Source: GenBank
Position: DSS3:2033982..2035076 (+ strand)
Length: 1095
Dbxref: GI:56696787
  GeneID:3192947
Note: dimethyl sulfoniopropionate (DMSP) demethylase; identified by match to protein family HMM PF01571
  NCBI:dimethylsulfonioproprionate demethylase DmdA
  IMG:dimethylsulfoniopropionate demethylase
codon_start: 1
load_id: SPO1913.p01
locus_tag: SPO1913
parent_id: SPO1913.t01
product: DmdA
protein_id: REF_tigr:SPO1913
  YP_167148.1
transl_table: 11
translation: MASIFPSRRVRRTPFSAGVEAAGVKGYTVYNHMLLPTVFDSLQADCAHLKEHVQVWDVAC ERQVSIQGPDALRLMKLISPRDMDRMADDQCYYVPTVDHRGGMLNDPVAVKLAADHYWLS LADGDLLQFGLGIAIARGFDVEIVEPDVSPLAVQGPRADDLMARVFGEAVRDIRFFRYKR LAFQGVELVVARSGWSKQGGFEIYVEGSELGMPLWNALFAAGADLNVRAGCPNNIERVES GLLSYGNDMTRENTPYECGLGKFCNSPEDYIGKAALAEQAKNGPARQIRALVIGGEIPPC QDAWPLLADGRQVGQVGSAIHSPEFGVNVAIGMVDRSHWAPGTGMEVETPDGMRPVTVRE GFWR
>dmdA class=Sequence position=DSS3:2033982..2035076 (+ strand)
ATGGCCAGCA TCTTCCCGTC CCGCCGGGTC CGGCGCACAC CTTTTTCCGC CGGTGTCGAG GCGGCCGGGG TCAAGGGCTA
TACCGTCTAC AATCACATGT TGCTGCCCAC GGTGTTCGAC AGCCTGCAGG CCGATTGCGC CCATCTGAAG GAACATGTGC
AGGTCTGGGA CGTGGCCTGC GAGCGGCAGG TCAGCATCCA GGGGCCCGAC GCGCTGCGGC TGATGAAGCT GATCAGCCCG
CGCGACATGG ACCGGATGGC CGATGACCAG TGTTACTACG TGCCCACGGT CGATCATCGT GGCGGCATGC TGAACGATCC
GGTGGCGGTG AAACTGGCCG CCGATCATTA CTGGCTGTCG CTGGCCGATG GCGACCTGCT GCAATTCGGG CTGGGGATTG
CGATCGCCCG GGGCTTCGAT GTCGAGATCG TCGAACCCGA TGTCTCGCCG CTGGCCGTGC AGGGACCCAG GGCCGACGAT
CTGATGGCGC GGGTCTTTGG CGAGGCGGTG CGCGATATCC GCTTTTTCCG CTACAAGCGG CTGGCCTTTC AGGGAGTCGA
GCTTGTGGTG GCGCGCTCAG GCTGGTCGAA ACAGGGCGGC TTCGAGATCT ATGTCGAGGG TTCGGAACTG GGCATGCCGC
TGTGGAACGC GCTGTTTGCC GCCGGTGCGG ACCTGAACGT GCGCGCGGGT TGCCCCAACA ATATCGAGCG CGTCGAGAGC
GGGTTGTTGA GCTATGGCAA CGACATGACC CGCGAGAACA CGCCGTATGA ATGCGGCCTG GGTAAGTTCT GCAATTCGCC
CGAGGACTAT ATCGGCAAGG CAGCACTGGC CGAACAGGCC AAGAACGGAC CGGCGCGCCA GATCCGGGCA CTGGTGATCG
GTGGCGAGAT TCCGCCCTGT CAGGATGCCT GGCCGCTGCT GGCCGACGGT CGCCAGGTGG GGCAGGTGGG GTCAGCGATC
CATTCCCCTG AATTCGGCGT GAATGTCGCG ATCGGCATGG TGGATCGCAG CCATTGGGCG CCGGGCACCG GGATGGAAGT
GGAAACGCCC GACGGCATGC GGCCGGTTAC GGTGCGCGAG GGGTTCTGGC GTTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7