Roseobase: Ruegeria pomeroyi DSS-3

Name: dnaJ
Type: CDS
Description: identified by similarity to SP:P08622; match to protein family HMM PF00226; match to protein family HMM PF00684; match to protein family HMM PF01556
Source: Genbank
Position: CP000031.2:44687..45832 (+ strand)
Length: 1146
Dbxref: NCBI_GP:AAV93375.1
IMG: dnaJ: chaperone protein DnaJ
Note: identified by similarity to SP:P08622; match to protein family HMM PF00226; match to protein family HMM PF00684; match to protein family HMM PF01556
RefSeq: SPO_RS00220: dnaJ: molecular chaperone DnaJ
gbkey: CDS
gene: dnaJ
load_id: cds-AAV93375.1
locus_tag: SPO0044
parent_id: gene-SPO0044
product: chaperone protein DnaJ
protein_id: AAV93375.1
transl_table: 11
translation: MSKRDYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKDNPDAESLFKEVNEAYEVLKDA EKKAAYDRFGHAAFEGGMGGGQRPGGGFGSGDFSSAFSDVFEDLFGDFMGGQRGGGGRRA ARGSDLRYNLRVTLEEAFSGLQKTINVPTAVACSSCEGTGAEGGVEPTTCPTCSGMGKVR AQQGFFTVERTCPTCSGLGQIIKNPCKSCRGQGRVEKDRALSVNIPAGVETGTRIRLAGE GEAGMRGGPPGDLYIFVEVAKHELFERDGVNLYCRVPVSMAKAALGGAIEVPTIDGGRGR VQVPAGSQSGRQMRLRSKGMPALRGGGIGDMFIELAVETPVNLTSKQKDLLREFDELSED NNPETKSFFSSVKSFWDGMKG
>dnaJ class=Sequence position=CP000031.2:44687..45832 (+ strand)
ATGTCAAAAC GCGACTATTA CGATGTGCTC GGCGTGTCCA AGGGCGCTTC GGCCGACGAG ATCAAGAAAG CCTATCGCGG
CAAGGCCAAG GAGCTGCATC CCGACCGCAA CAAGGACAAT CCGGATGCCG AGTCGCTGTT CAAGGAAGTG AACGAGGCTT
ATGAGGTCCT GAAGGATGCC GAGAAGAAGG CCGCCTATGA CCGGTTCGGC CATGCCGCGT TCGAAGGCGG CATGGGCGGC
GGTCAGCGTC CCGGTGGCGG TTTCGGGTCG GGCGATTTTT CCAGCGCCTT CTCGGATGTG TTCGAGGACC TGTTCGGCGA
TTTCATGGGT GGCCAGCGGG GTGGCGGTGG CCGCCGCGCT GCGCGCGGCT CGGACCTGCG ATACAACCTG CGGGTCACGC
TGGAAGAGGC GTTCTCGGGC CTGCAAAAGA CCATCAACGT GCCCACCGCG GTTGCCTGTT CGTCCTGCGA GGGCACCGGT
GCCGAAGGCG GGGTCGAGCC GACCACCTGT CCGACCTGTT CGGGCATGGG CAAGGTGCGC GCACAGCAGG GCTTCTTTAC
CGTCGAGCGG ACCTGTCCGA CCTGTTCGGG TCTGGGTCAG ATCATCAAGA ACCCCTGCAA ATCCTGCCGC GGTCAGGGTC
GGGTCGAAAA GGACCGTGCG CTGAGCGTCA ATATCCCCGC CGGGGTCGAA ACCGGCACCC GCATTCGCCT GGCCGGTGAA
GGCGAGGCCG GGATGCGCGG TGGCCCGCCG GGCGATCTCT ATATCTTTGT CGAGGTCGCC AAGCACGAGC TGTTCGAACG
CGACGGCGTG AACCTCTATT GCCGGGTGCC GGTCAGCATG GCTAAGGCGG CGCTGGGTGG CGCCATCGAG GTGCCGACCA
TCGACGGCGG CCGGGGCCGG GTGCAGGTGC CCGCCGGCAG CCAGTCAGGC CGGCAGATGC GCCTGCGCAG CAAGGGCATG
CCAGCCCTGC GCGGTGGCGG CATCGGTGAC ATGTTCATCG AACTGGCGGT GGAAACTCCG GTCAACCTGA CCAGCAAGCA
GAAAGATCTG CTGCGCGAGT TCGACGAGCT GAGCGAGGAC AACAATCCCG AGACCAAGAG CTTCTTTTCC TCGGTCAAGT
CGTTCTGGGA CGGGATGAAG GGTTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7