Roseobase: Ruegeria pomeroyi DSS-3

Name: dnaJ
Type: gene
Description:
Source: GenBank
Position: DSS3:44687..45832 (+ strand)
Length: 1146
Dbxref: GeneID:3196511
load_id: SPO0044
locus_tag: SPO0044
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:44687..45832 (+ strand)
Length: 1146
load_id: SPO0044.t01
parent_id: SPO0044
Parts:
Type: CDS
Description: identified by similarity to SP:P08622; match to protein family HMM PF00226; match to protein family HMM PF00684; match to protein family HMM PF01556; NCBI:molecular chaperone DnaJ; IMG:molecular chaperone DnaJ
Source: GenBank
Position: DSS3:44687..45832 (+ strand)
Length: 1146
Dbxref: GI:56694972
  GeneID:3196511
Note: identified by similarity to SP:P08622; match to protein family HMM PF00226; match to protein family HMM PF00684; match to protein family HMM PF01556
  NCBI:molecular chaperone DnaJ
  IMG:molecular chaperone DnaJ
codon_start: 1
load_id: SPO0044.p01
locus_tag: SPO0044
parent_id: SPO0044.t01
product: chaperone protein DnaJ
protein_id: REF_tigr:SPO0044
  YP_165317.1
transl_table: 11
translation: MSKRDYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKDNPDAESLFKEVNEAYEVLKDA EKKAAYDRFGHAAFEGGMGGGQRPGGGFGSGDFSSAFSDVFEDLFGDFMGGQRGGGGRRA ARGSDLRYNLRVTLEEAFSGLQKTINVPTAVACSSCEGTGAEGGVEPTTCPTCSGMGKVR AQQGFFTVERTCPTCSGLGQIIKNPCKSCRGQGRVEKDRALSVNIPAGVETGTRIRLAGE GEAGMRGGPPGDLYIFVEVAKHELFERDGVNLYCRVPVSMAKAALGGAIEVPTIDGGRGR VQVPAGSQSGRQMRLRSKGMPALRGGGIGDMFIELAVETPVNLTSKQKDLLREFDELSED NNPETKSFFSSVKSFWDGMKG
Type: exon
Description:
Source: GenBank
Position: DSS3:44687..45832 (+ strand)
Length: 1146
parent_id: SPO0044.t01
> class=Sequence position=DSS3:44687..45832 (+ strand)
ATGTCAAAAC GCGACTATTA CGATGTGCTC GGCGTGTCCA AGGGCGCTTC GGCCGACGAG ATCAAGAAAG CCTATCGCGG
CAAGGCCAAG GAGCTGCATC CCGACCGCAA CAAGGACAAT CCGGATGCCG AGTCGCTGTT CAAGGAAGTG AACGAGGCTT
ATGAGGTCCT GAAGGATGCC GAGAAGAAGG CCGCCTATGA CCGGTTCGGC CATGCCGCGT TCGAAGGCGG CATGGGCGGC
GGTCAGCGTC CCGGTGGCGG TTTCGGGTCG GGCGATTTTT CCAGCGCCTT CTCGGATGTG TTCGAGGACC TGTTCGGCGA
TTTCATGGGT GGCCAGCGGG GTGGCGGTGG CCGCCGCGCT GCGCGCGGCT CGGACCTGCG ATACAACCTG CGGGTCACGC
TGGAAGAGGC GTTCTCGGGC CTGCAAAAGA CCATCAACGT GCCCACCGCG GTTGCCTGTT CGTCCTGCGA GGGCACCGGT
GCCGAAGGCG GGGTCGAGCC GACCACCTGT CCGACCTGTT CGGGCATGGG CAAGGTGCGC GCACAGCAGG GCTTCTTTAC
CGTCGAGCGG ACCTGTCCGA CCTGTTCGGG TCTGGGTCAG ATCATCAAGA ACCCCTGCAA ATCCTGCCGC GGTCAGGGTC
GGGTCGAAAA GGACCGTGCG CTGAGCGTCA ATATCCCCGC CGGGGTCGAA ACCGGCACCC GCATTCGCCT GGCCGGTGAA
GGCGAGGCCG GGATGCGCGG TGGCCCGCCG GGCGATCTCT ATATCTTTGT CGAGGTCGCC AAGCACGAGC TGTTCGAACG
CGACGGCGTG AACCTCTATT GCCGGGTGCC GGTCAGCATG GCTAAGGCGG CGCTGGGTGG CGCCATCGAG GTGCCGACCA
TCGACGGCGG CCGGGGCCGG GTGCAGGTGC CCGCCGGCAG CCAGTCAGGC CGGCAGATGC GCCTGCGCAG CAAGGGCATG
CCAGCCCTGC GCGGTGGCGG CATCGGTGAC ATGTTCATCG AACTGGCGGT GGAAACTCCG GTCAACCTGA CCAGCAAGCA
GAAAGATCTG CTGCGCGAGT TCGACGAGCT GAGCGAGGAC AACAATCCCG AGACCAAGAG CTTCTTTTCC TCGGTCAAGT
CGTTCTGGGA CGGGATGAAG GGTTAG
>dnaJ class=Sequence position=DSS3:44687..45832 (+ strand)
ATGTCAAAAC GCGACTATTA CGATGTGCTC GGCGTGTCCA AGGGCGCTTC GGCCGACGAG ATCAAGAAAG CCTATCGCGG
CAAGGCCAAG GAGCTGCATC CCGACCGCAA CAAGGACAAT CCGGATGCCG AGTCGCTGTT CAAGGAAGTG AACGAGGCTT
ATGAGGTCCT GAAGGATGCC GAGAAGAAGG CCGCCTATGA CCGGTTCGGC CATGCCGCGT TCGAAGGCGG CATGGGCGGC
GGTCAGCGTC CCGGTGGCGG TTTCGGGTCG GGCGATTTTT CCAGCGCCTT CTCGGATGTG TTCGAGGACC TGTTCGGCGA
TTTCATGGGT GGCCAGCGGG GTGGCGGTGG CCGCCGCGCT GCGCGCGGCT CGGACCTGCG ATACAACCTG CGGGTCACGC
TGGAAGAGGC GTTCTCGGGC CTGCAAAAGA CCATCAACGT GCCCACCGCG GTTGCCTGTT CGTCCTGCGA GGGCACCGGT
GCCGAAGGCG GGGTCGAGCC GACCACCTGT CCGACCTGTT CGGGCATGGG CAAGGTGCGC GCACAGCAGG GCTTCTTTAC
CGTCGAGCGG ACCTGTCCGA CCTGTTCGGG TCTGGGTCAG ATCATCAAGA ACCCCTGCAA ATCCTGCCGC GGTCAGGGTC
GGGTCGAAAA GGACCGTGCG CTGAGCGTCA ATATCCCCGC CGGGGTCGAA ACCGGCACCC GCATTCGCCT GGCCGGTGAA
GGCGAGGCCG GGATGCGCGG TGGCCCGCCG GGCGATCTCT ATATCTTTGT CGAGGTCGCC AAGCACGAGC TGTTCGAACG
CGACGGCGTG AACCTCTATT GCCGGGTGCC GGTCAGCATG GCTAAGGCGG CGCTGGGTGG CGCCATCGAG GTGCCGACCA
TCGACGGCGG CCGGGGCCGG GTGCAGGTGC CCGCCGGCAG CCAGTCAGGC CGGCAGATGC GCCTGCGCAG CAAGGGCATG
CCAGCCCTGC GCGGTGGCGG CATCGGTGAC ATGTTCATCG AACTGGCGGT GGAAACTCCG GTCAACCTGA CCAGCAAGCA
GAAAGATCTG CTGCGCGAGT TCGACGAGCT GAGCGAGGAC AACAATCCCG AGACCAAGAG CTTCTTTTCC TCGGTCAAGT
CGTTCTGGGA CGGGATGAAG GGTTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7