Roseobase: Ruegeria pomeroyi DSS-3

Name: dnaK
Type: CDS
Description: identified by similarity to SP:P04475; match to protein family HMM PF00012; NCBI:molecular chaperone DnaK; IMG:molecular chaperone DnaK
Source: GenBank
Position: DSS3:42698..44611 (+ strand)
Length: 1914
Dbxref: GI:56694971
  GeneID:3195579
Note: identified by similarity to SP:P04475; match to protein family HMM PF00012
  NCBI:molecular chaperone DnaK
  IMG:molecular chaperone DnaK
codon_start: 1
load_id: SPO0043.p01
locus_tag: SPO0043
parent_id: SPO0043.t01
product: chaperone protein DnaK
protein_id: REF_tigr:SPO0043
  YP_165316.1
transl_table: 11
translation: MGKVIGIDLGTTNSCVAIMDGAQPKVIENSEGARTTPSIVAFTDEERLVGQPAKRQAVTN PSNTIFGVKRLIGRRVDDAEVTKDKKMVPFTIVNGGNGDAWVEAKGEKYSPSQISAVILG KMKETAESYLGEEVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGL DKKNSQTIAVYDLGGGTFDVTILEIDDGLFEVKSTNGDTFLGGEDFDMRIVNYLADEFKK EHGVDLSGDKMALQRLKEAAEKAKIELSSTTQTEINQPFISMGANGQPLHLVMKLTRAKL ESLVGDLIKKSMDPCKAALKDAGISPSDVDEVVLVGGMTRMPKVFEEVTKFFGKEPHKGV NPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIETLGGVFTRLIDRNTTIPTKKSQV FSTAEDNQNAVTIRVFQGEREMAADNKILGQFNLEDIPPAPRGMPQIEVTFDIDANGIVS VSAKDKGTGKEHKITIQASGGLSDEDIEKMVKDAEENAEADKARKELVEARNQAESLIHS TEKSVEEHGDKVDPTTVEAIELAIAALKDDLDKDGVSAEKIKSGLQNVTEAAMKLGEAIY KAQSEGGDDEPAAADARPSDDDIVDAEFEDLGEDKRK
>dnaK class=Sequence position=DSS3:42698..44611 (+ strand)
ATGGGTAAAG TTATCGGTAT CGACCTGGGC ACCACCAACT CGTGTGTTGC CATCATGGAC GGCGCCCAGC CGAAAGTCAT
CGAAAACTCG GAAGGGGCGC GGACCACGCC CTCGATCGTC GCCTTCACCG ATGAAGAGCG TCTGGTCGGT CAGCCGGCAA
AACGCCAGGC GGTCACCAAC CCCTCGAACA CCATTTTTGG CGTCAAGCGC CTGATCGGCC GCCGGGTCGA CGATGCCGAG
GTCACCAAGG ACAAGAAAAT GGTGCCGTTC ACCATCGTCA ACGGTGGCAA TGGCGACGCA TGGGTCGAGG CCAAGGGCGA
GAAATACTCG CCGTCGCAAA TTTCTGCCGT CATCCTCGGC AAGATGAAGG AAACCGCAGA ATCCTATCTG GGCGAGGAAG
TGACCCAGGC AGTGATCACG GTGCCCGCCT ATTTCAACGA TGCCCAGCGT CAGGCCACCA AGGACGCCGG CAAGATCGCC
GGTCTGGAAG TGCTGCGCAT CATCAACGAG CCGACCGCGG CTGCGTTGGC TTATGGCCTG GACAAGAAGA ACAGCCAGAC
CATCGCCGTC TATGACCTTG GCGGCGGTAC TTTCGACGTG ACCATCCTGG AAATCGACGA CGGCCTGTTC GAGGTCAAGT
CGACCAATGG CGACACCTTC CTGGGTGGCG AAGATTTCGA CATGCGGATC GTCAACTATC TGGCGGACGA GTTCAAGAAA
GAGCACGGTG TCGACCTGTC CGGCGACAAG ATGGCGCTGC AGCGCCTGAA GGAAGCCGCC GAAAAGGCCA AGATCGAGCT
GAGCTCGACC ACCCAGACCG AAATCAACCA GCCGTTCATC TCGATGGGCG CCAATGGTCA GCCGCTGCAT CTGGTGATGA
AGCTGACCCG CGCCAAGCTG GAAAGCCTGG TTGGCGATCT GATCAAGAAG TCGATGGACC CGTGCAAGGC CGCTCTCAAG
GATGCCGGCA TTTCGCCGTC GGACGTGGAC GAGGTGGTTC TGGTCGGCGG CATGACCCGC ATGCCCAAGG TTTTCGAGGA
AGTGACCAAG TTCTTCGGCA AGGAGCCGCA CAAGGGCGTG AACCCCGATG AGGTGGTTGC CATGGGCGCC GCCATTCAGG
CCGGTGTTCT GCAAGGCGAC GTCAAGGATG TTGTCCTGCT CGACGTGACC CCGCTGTCGC TTGGCATCGA GACCCTGGGC
GGCGTGTTCA CCCGTCTGAT CGACCGCAAC ACCACGATCC CGACCAAGAA AAGCCAGGTC TTCTCGACCG CCGAGGACAA
CCAGAACGCG GTGACCATCC GCGTGTTCCA GGGCGAGCGC GAGATGGCGG CCGACAACAA GATCCTCGGC CAGTTCAATC
TGGAGGACAT CCCGCCGGCA CCGCGCGGCA TGCCCCAGAT CGAGGTGACA TTCGACATCG ACGCCAACGG CATCGTGTCG
GTCTCGGCCA AGGACAAGGG CACCGGCAAG GAACACAAGA TCACCATCCA GGCCTCGGGC GGTCTCTCGG ACGAAGACAT
CGAAAAGATG GTCAAGGATG CCGAGGAAAA CGCCGAAGCC GACAAGGCCC GCAAAGAGCT GGTCGAGGCG CGCAACCAGG
CCGAAAGCCT GATCCATTCG ACCGAGAAGT CGGTCGAAGA GCATGGCGAC AAGGTCGACC CGACCACCGT CGAGGCCATC
GAACTGGCCA TTGCCGCGCT GAAGGACGAT CTGGACAAGG ACGGCGTGAG CGCCGAGAAG ATCAAATCGG GCCTGCAGAA
CGTGACCGAA GCGGCCATGA AGCTGGGCGA GGCGATCTAT AAGGCGCAGA GCGAAGGCGG CGATGACGAG CCCGCAGCGG
CGGATGCACG TCCGTCGGAC GACGACATCG TCGATGCCGA GTTCGAGGAT CTCGGCGAAG ACAAGCGAAA GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7