Roseobase: Ruegeria pomeroyi DSS-3

Name: fabI-1
Type: CDS
Description: identified by similarity to SP:P29132; match to protein family HMM PF00106
Source: Genbank
Position: CP000031.2:120115..120879 (+ strand)
Length: 765
Dbxref: NCBI_GP:AAV93443.1
IMG: fabI-1: Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)
Note: identified by similarity to SP:P29132; match to protein family HMM PF00106
RefSeq: SPO_RS00565: fabI: enoyl-ACP reductase FabI
gbkey: CDS
gene: fabI-1
load_id: cds-AAV93443.1
locus_tag: SPO0113
parent_id: gene-SPO0113
product: enoyl-(acyl-carrier-protein) reductase
protein_id: AAV93443.1
transl_table: 11
translation: MGLLDGKRGLVVGIANERSIASGCAQAFHREGAELAVTYLNEKARPFVQPVAEALDAEIF MPLDVTADAEMDALFEAIASSWGRLDFILHSVAYCPKEDLHGNVLDCSREGFSAAMDISV HSFMRLARRARPLMQNGGCLLTVSYYGAEKVVDHYNVMGPVKAALESTVKYMAAELGPEG IRVNALSPGPLMTRAASGIAHFDALIDEARARAPQQRLVTIEDVGNMAAGLVSDAARNVT GNISYVDAGYHVMS
>fabI-1 class=Sequence position=CP000031.2:120115..120879 (+ strand)
ATGGGCTTGC TTGACGGAAA GCGCGGTCTC GTGGTCGGGA TCGCCAACGA ACGCTCGATC GCCAGCGGTT GCGCGCAAGC
CTTCCATCGG GAAGGTGCCG AACTTGCGGT TACTTATCTC AACGAAAAGG CGCGGCCGTT CGTGCAACCG GTCGCCGAGG
CGCTGGACGC TGAAATCTTC ATGCCGCTGG ATGTCACAGC CGATGCGGAG ATGGATGCGC TGTTCGAGGC CATTGCCTCC
TCATGGGGGC GCCTCGATTT CATCCTGCAC TCGGTCGCCT ACTGTCCGAA GGAAGATCTG CACGGAAATG TTCTCGATTG
TTCGCGGGAA GGCTTTAGCG CGGCGATGGA CATTTCGGTT CACTCGTTCA TGCGGCTTGC TCGCAGGGCA CGACCGCTGA
TGCAGAACGG CGGTTGCCTG CTGACGGTCA GCTATTACGG CGCAGAAAAG GTGGTCGACC ATTACAATGT GATGGGTCCG
GTCAAGGCCG CCCTGGAATC GACTGTCAAA TACATGGCGG CTGAACTCGG ACCGGAAGGC ATCCGGGTCA ATGCGCTGTC
GCCGGGCCCG CTGATGACCC GTGCCGCCTC TGGCATTGCA CATTTCGATG CGCTGATCGA CGAGGCACGC GCGCGCGCGC
CGCAGCAGCG GCTGGTGACC ATCGAGGATG TCGGCAACAT GGCCGCGGGC CTTGTGAGCG ATGCCGCGCG CAATGTGACC
GGCAACATTT CTTACGTCGA CGCCGGATAT CATGTCATGT CCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7