Roseobase: Ruegeria pomeroyi DSS-3

Name: fabI-1
Type: gene
Description:
Source: GenBank
Position: DSS3:120115..120879 (+ strand)
Length: 765
Dbxref: GeneID:3196492
load_id: SPO0113
locus_tag: SPO0113
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:120115..120879 (+ strand)
Length: 765
load_id: SPO0113.t01
parent_id: SPO0113
Parts:
Type: CDS
Description: identified by similarity to SP:P29132; match to protein family HMM PF00106; NCBI:enoyl-[acyl-carrier-protein] reductase; IMG:Enoyl-[acyl-carrier-protein] reductase [NADH]
Source: GenBank
Position: DSS3:120115..120879 (+ strand)
Length: 765
Dbxref: GI:56695040
  GeneID:3196492
Note: identified by similarity to SP:P29132; match to protein family HMM PF00106
  NCBI:enoyl-[acyl-carrier-protein] reductase
  IMG:Enoyl-[acyl-carrier-protein] reductase [NADH]
codon_start: 1
eC_number: 1.3.1.9
load_id: SPO0113.p01
locus_tag: SPO0113
parent_id: SPO0113.t01
product: enoyl-(acyl-carrier-protein) reductase
protein_id: REF_tigr:SPO0113
  YP_165387.1
transl_table: 11
translation: MGLLDGKRGLVVGIANERSIASGCAQAFHREGAELAVTYLNEKARPFVQPVAEALDAEIF MPLDVTADAEMDALFEAIASSWGRLDFILHSVAYCPKEDLHGNVLDCSREGFSAAMDISV HSFMRLARRARPLMQNGGCLLTVSYYGAEKVVDHYNVMGPVKAALESTVKYMAAELGPEG IRVNALSPGPLMTRAASGIAHFDALIDEARARAPQQRLVTIEDVGNMAAGLVSDAARNVT GNISYVDAGYHVMS
Type: exon
Description:
Source: GenBank
Position: DSS3:120115..120879 (+ strand)
Length: 765
parent_id: SPO0113.t01
> class=Sequence position=DSS3:120115..120879 (+ strand)
ATGGGCTTGC TTGACGGAAA GCGCGGTCTC GTGGTCGGGA TCGCCAACGA ACGCTCGATC GCCAGCGGTT GCGCGCAAGC
CTTCCATCGG GAAGGTGCCG AACTTGCGGT TACTTATCTC AACGAAAAGG CGCGGCCGTT CGTGCAACCG GTCGCCGAGG
CGCTGGACGC TGAAATCTTC ATGCCGCTGG ATGTCACAGC CGATGCGGAG ATGGATGCGC TGTTCGAGGC CATTGCCTCC
TCATGGGGGC GCCTCGATTT CATCCTGCAC TCGGTCGCCT ACTGTCCGAA GGAAGATCTG CACGGAAATG TTCTCGATTG
TTCGCGGGAA GGCTTTAGCG CGGCGATGGA CATTTCGGTT CACTCGTTCA TGCGGCTTGC TCGCAGGGCA CGACCGCTGA
TGCAGAACGG CGGTTGCCTG CTGACGGTCA GCTATTACGG CGCAGAAAAG GTGGTCGACC ATTACAATGT GATGGGTCCG
GTCAAGGCCG CCCTGGAATC GACTGTCAAA TACATGGCGG CTGAACTCGG ACCGGAAGGC ATCCGGGTCA ATGCGCTGTC
GCCGGGCCCG CTGATGACCC GTGCCGCCTC TGGCATTGCA CATTTCGATG CGCTGATCGA CGAGGCACGC GCGCGCGCGC
CGCAGCAGCG GCTGGTGACC ATCGAGGATG TCGGCAACAT GGCCGCGGGC CTTGTGAGCG ATGCCGCGCG CAATGTGACC
GGCAACATTT CTTACGTCGA CGCCGGATAT CATGTCATGT CCTGA
>fabI-1 class=Sequence position=DSS3:120115..120879 (+ strand)
ATGGGCTTGC TTGACGGAAA GCGCGGTCTC GTGGTCGGGA TCGCCAACGA ACGCTCGATC GCCAGCGGTT GCGCGCAAGC
CTTCCATCGG GAAGGTGCCG AACTTGCGGT TACTTATCTC AACGAAAAGG CGCGGCCGTT CGTGCAACCG GTCGCCGAGG
CGCTGGACGC TGAAATCTTC ATGCCGCTGG ATGTCACAGC CGATGCGGAG ATGGATGCGC TGTTCGAGGC CATTGCCTCC
TCATGGGGGC GCCTCGATTT CATCCTGCAC TCGGTCGCCT ACTGTCCGAA GGAAGATCTG CACGGAAATG TTCTCGATTG
TTCGCGGGAA GGCTTTAGCG CGGCGATGGA CATTTCGGTT CACTCGTTCA TGCGGCTTGC TCGCAGGGCA CGACCGCTGA
TGCAGAACGG CGGTTGCCTG CTGACGGTCA GCTATTACGG CGCAGAAAAG GTGGTCGACC ATTACAATGT GATGGGTCCG
GTCAAGGCCG CCCTGGAATC GACTGTCAAA TACATGGCGG CTGAACTCGG ACCGGAAGGC ATCCGGGTCA ATGCGCTGTC
GCCGGGCCCG CTGATGACCC GTGCCGCCTC TGGCATTGCA CATTTCGATG CGCTGATCGA CGAGGCACGC GCGCGCGCGC
CGCAGCAGCG GCTGGTGACC ATCGAGGATG TCGGCAACAT GGCCGCGGGC CTTGTGAGCG ATGCCGCGCG CAATGTGACC
GGCAACATTT CTTACGTCGA CGCCGGATAT CATGTCATGT CCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7