Roseobase: Ruegeria pomeroyi DSS-3

Name: gidA
Type: gene
Description:
Source: GenBank
Position: DSS3:1..1869 (+ strand)
Length: 1869
Dbxref: GeneID:3194636
load_id: SPO0001
locus_tag: SPO0001
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:1..1869 (+ strand)
Length: 1869
load_id: SPO0001.t01
parent_id: SPO0001
Parts:
Type: CDS
Description: identified by similarity to SP:P17112; match to protein family HMM PF01134; match to protein family HMM TIGR00136; NCBI:tRNA uridine(34) 5-carboxymethylaminomethyl synthesis enzyme MnmG; IMG:
Source: GenBank
Position: DSS3:1..1869 (+ strand)
Length: 1869
Dbxref: GI:56694929
  GeneID:3194636
Note: identified by similarity to SP:P17112; match to protein family HMM PF01134; match to protein family HMM TIGR00136
  NCBI:tRNA uridine(34) 5-carboxymethylaminomethyl synthesis enzyme MnmG
  IMG:
codon_start: 1
load_id: SPO0001.p01
locus_tag: SPO0001
parent_id: SPO0001.t01
product: glucose inhibited division protein A
protein_id: REF_tigr:SPO0001
  YP_165274.1
transl_table: 11
translation: MKHSDFDIVVIGAGHAGAEAAHAAARMGMRTALVSLSERDIGVMSCNPAIGGLGKGHLVR EIDALDGVMGRVADKAGIQFRLLNRRKGPAVQGPRAQADRKLYRLAMQEEMRNRPGLTIV EGEVTDFRMQGDRVAGVVLADGSEIASQAVILTSGTFLRGIIHIGDVSRPGGRMGDRPSV PLAERLDGFALPMGRLKTGTPPRLDGRTIDWSILERQDGDDDPVLFSFLSKGAYARQIAC GITHTNAQTHEIIRKNLSRSAMYGGHIEGVGPRYCPSIEDKIVRFADKDSHQIFLEPEGL EDHTVYPNGISTSLPVDVQEDYVRSIRGLEQVEILQPGYAIEYDYVDPRALTSQLSLPNV PGLYLAGQINGTTGYEEAAAQGMVAGLNAATAILGHEPVPFSRANSYIGVMIDDLTTRGV AEPYRMFTSRAEFRLSLRADNADQRLTPLGLELGCVGDERRDVFARKAEKLATASALLDQ SSFSPKEIATAGITISQDGNRRNGFAVLAFPDVRFDDLVPLIPELADTDAETRAQVERDA LYANYIARQERDVEAMKRDEALVIPIDFNFSALDGLSNELKQKLTSARPENIAQAGRVEG MTPAALALILARLRRGDRARSA
Type: exon
Description:
Source: GenBank
Position: DSS3:1..1869 (+ strand)
Length: 1869
parent_id: SPO0001.t01
> class=Sequence position=DSS3:1..1869 (+ strand)
GTGAAACATT CGGATTTCGA TATTGTCGTG ATCGGGGCCG GACATGCCGG CGCCGAGGCT GCACATGCTG CGGCACGCAT
GGGAATGCGT ACTGCCTTGG TTTCCCTGTC CGAACGCGAC ATTGGCGTGA TGTCCTGTAA CCCGGCTATT GGCGGTTTGG
GTAAGGGGCA TCTGGTTCGC GAGATCGACG CACTTGACGG GGTCATGGGG CGGGTGGCCG ACAAGGCCGG GATTCAATTT
CGTCTGCTCA ATCGGCGCAA GGGTCCTGCG GTCCAGGGGC CGCGCGCTCA GGCCGATCGC AAGCTCTATC GCCTGGCGAT
GCAGGAAGAA ATGCGCAATC GCCCCGGACT GACCATCGTC GAGGGCGAGG TTACTGATTT TCGAATGCAA GGTGATCGCG
TTGCCGGCGT CGTTCTGGCC GATGGGTCCG AGATTGCATC GCAAGCCGTG ATCTTGACCT CGGGCACGTT CCTGCGCGGG
ATCATTCATA TTGGCGATGT TTCGCGCCCC GGTGGGCGGA TGGGTGACCG ACCTTCAGTT CCGCTTGCCG AAAGGCTGGA
TGGATTTGCG TTACCGATGG GGCGACTAAA GACCGGAACG CCGCCGCGAC TGGACGGACG CACCATAGAC TGGTCTATCC
TCGAGCGTCA GGACGGGGAT GACGATCCGG TGCTGTTCTC GTTCCTGTCA AAAGGGGCCT ATGCGCGTCA GATCGCCTGC
GGTATCACGC ATACCAACGC CCAGACGCAT GAGATCATTC GCAAAAACCT GTCCCGTTCC GCGATGTATG GCGGACATAT
CGAAGGCGTC GGCCCTCGTT ACTGCCCCTC GATCGAGGAC AAAATCGTGC GTTTCGCTGA CAAGGATTCG CATCAGATCT
TTCTTGAGCC CGAGGGGCTG GAAGATCACA CTGTCTATCC GAACGGTATC TCGACCTCGT TGCCGGTCGA CGTGCAAGAG
GACTATGTCC GTTCGATCCG GGGGCTGGAA CAGGTTGAGA TCTTGCAGCC CGGTTACGCG ATCGAATACG ACTATGTTGA
TCCCCGCGCG CTCACGTCGC AACTGTCTCT GCCGAATGTT CCGGGCTTGT ACCTAGCCGG TCAGATCAAT GGAACAACCG
GGTATGAAGA GGCTGCGGCG CAGGGAATGG TTGCCGGGTT GAACGCAGCC ACCGCGATTT TGGGTCACGA ACCGGTCCCC
TTCAGTCGTG CCAACAGCTA TATCGGTGTG ATGATCGACG ATCTGACCAC ACGCGGTGTG GCAGAGCCCT ATCGCATGTT
CACCTCGCGG GCCGAATTCC GCCTGTCCTT GCGTGCGGAT AACGCGGATC AGCGGCTGAC GCCCTTGGGA TTGGAATTGG
GTTGTGTCGG TGACGAACGG CGCGACGTCT TTGCGCGTAA GGCAGAGAAA CTGGCGACAG CCTCGGCGCT GCTCGATCAG
AGCAGCTTTA GCCCCAAAGA GATTGCCACA GCTGGTATCA CCATCAGTCA GGACGGCAAT CGGAGAAACG GCTTCGCTGT
CCTCGCCTTT CCGGACGTCA GGTTTGACGA CCTTGTGCCA CTAATCCCGG AACTTGCAGA CACCGACGCC GAAACCCGCG
CGCAGGTAGA GCGTGATGCG CTTTATGCCA ATTACATCGC GCGGCAGGAA CGGGATGTTG AGGCGATGAA ACGGGATGAG
GCGCTGGTCA TTCCGATCGA CTTCAACTTT TCTGCCCTCG ATGGGTTGTC AAATGAGTTG AAGCAAAAAC TCACATCCGC
GCGACCGGAA AATATCGCGC AGGCCGGGCG TGTTGAGGGG ATGACGCCAG CGGCGCTTGC GCTCATCCTG GCCCGCCTTC
GCCGTGGCGA CCGAGCACGA AGCGCATGA
>gidA class=Sequence position=DSS3:1..1869 (+ strand)
GTGAAACATT CGGATTTCGA TATTGTCGTG ATCGGGGCCG GACATGCCGG CGCCGAGGCT GCACATGCTG CGGCACGCAT
GGGAATGCGT ACTGCCTTGG TTTCCCTGTC CGAACGCGAC ATTGGCGTGA TGTCCTGTAA CCCGGCTATT GGCGGTTTGG
GTAAGGGGCA TCTGGTTCGC GAGATCGACG CACTTGACGG GGTCATGGGG CGGGTGGCCG ACAAGGCCGG GATTCAATTT
CGTCTGCTCA ATCGGCGCAA GGGTCCTGCG GTCCAGGGGC CGCGCGCTCA GGCCGATCGC AAGCTCTATC GCCTGGCGAT
GCAGGAAGAA ATGCGCAATC GCCCCGGACT GACCATCGTC GAGGGCGAGG TTACTGATTT TCGAATGCAA GGTGATCGCG
TTGCCGGCGT CGTTCTGGCC GATGGGTCCG AGATTGCATC GCAAGCCGTG ATCTTGACCT CGGGCACGTT CCTGCGCGGG
ATCATTCATA TTGGCGATGT TTCGCGCCCC GGTGGGCGGA TGGGTGACCG ACCTTCAGTT CCGCTTGCCG AAAGGCTGGA
TGGATTTGCG TTACCGATGG GGCGACTAAA GACCGGAACG CCGCCGCGAC TGGACGGACG CACCATAGAC TGGTCTATCC
TCGAGCGTCA GGACGGGGAT GACGATCCGG TGCTGTTCTC GTTCCTGTCA AAAGGGGCCT ATGCGCGTCA GATCGCCTGC
GGTATCACGC ATACCAACGC CCAGACGCAT GAGATCATTC GCAAAAACCT GTCCCGTTCC GCGATGTATG GCGGACATAT
CGAAGGCGTC GGCCCTCGTT ACTGCCCCTC GATCGAGGAC AAAATCGTGC GTTTCGCTGA CAAGGATTCG CATCAGATCT
TTCTTGAGCC CGAGGGGCTG GAAGATCACA CTGTCTATCC GAACGGTATC TCGACCTCGT TGCCGGTCGA CGTGCAAGAG
GACTATGTCC GTTCGATCCG GGGGCTGGAA CAGGTTGAGA TCTTGCAGCC CGGTTACGCG ATCGAATACG ACTATGTTGA
TCCCCGCGCG CTCACGTCGC AACTGTCTCT GCCGAATGTT CCGGGCTTGT ACCTAGCCGG TCAGATCAAT GGAACAACCG
GGTATGAAGA GGCTGCGGCG CAGGGAATGG TTGCCGGGTT GAACGCAGCC ACCGCGATTT TGGGTCACGA ACCGGTCCCC
TTCAGTCGTG CCAACAGCTA TATCGGTGTG ATGATCGACG ATCTGACCAC ACGCGGTGTG GCAGAGCCCT ATCGCATGTT
CACCTCGCGG GCCGAATTCC GCCTGTCCTT GCGTGCGGAT AACGCGGATC AGCGGCTGAC GCCCTTGGGA TTGGAATTGG
GTTGTGTCGG TGACGAACGG CGCGACGTCT TTGCGCGTAA GGCAGAGAAA CTGGCGACAG CCTCGGCGCT GCTCGATCAG
AGCAGCTTTA GCCCCAAAGA GATTGCCACA GCTGGTATCA CCATCAGTCA GGACGGCAAT CGGAGAAACG GCTTCGCTGT
CCTCGCCTTT CCGGACGTCA GGTTTGACGA CCTTGTGCCA CTAATCCCGG AACTTGCAGA CACCGACGCC GAAACCCGCG
CGCAGGTAGA GCGTGATGCG CTTTATGCCA ATTACATCGC GCGGCAGGAA CGGGATGTTG AGGCGATGAA ACGGGATGAG
GCGCTGGTCA TTCCGATCGA CTTCAACTTT TCTGCCCTCG ATGGGTTGTC AAATGAGTTG AAGCAAAAAC TCACATCCGC
GCGACCGGAA AATATCGCGC AGGCCGGGCG TGTTGAGGGG ATGACGCCAG CGGCGCTTGC GCTCATCCTG GCCCGCCTTC
GCCGTGGCGA CCGAGCACGA AGCGCATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7