Roseobase: Ruegeria pomeroyi DSS-3

Name: gidB
Type: gene
Description:
Source: Genbank
Position: CP000031.2:1866..2480 (+ strand)
Length: 615
gbkey: Gene
gene: gidB
gene_biotype: protein_coding
load_id: gene-SPO0002
locus_tag: SPO0002
Parts:
Type: CDS
Description: identified by match to protein family HMM PF02527; match to protein family HMM TIGR00138
Source: Genbank
Position: CP000031.2:1866..2480 (+ strand)
Length: 615
Dbxref: NCBI_GP:AAV93333.1
IMG: gidB: 16S rRNA m(7)G-527 methyltransferase (EC 2.1.1.170)
Note: identified by match to protein family HMM PF02527; match to protein family HMM TIGR00138
RefSeq: SPO_RS22355: rsmG: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
gbkey: CDS
gene: gidB
load_id: cds-AAV93333.1
locus_tag: SPO0002
parent_id: gene-SPO0002
product: glucose-inhibited division protein B
protein_id: AAV93333.1
transl_table: 11
translation: MMVPDANTLNVSRETFERLKIFADLVHKWNPRINLVSKRSLEDLWTRHIIDSIQVFRNAP KGDLWVDLGSGGGFPGLICAILAAEEKPETQFICVESDQRKSAFLRSAARECGIACQVIS ERIEHLDPLDADILSARALTDLTGLLGFAERHLKIGGTALFPKGAAWKKELQDAAKQWNF SYDAVTSLTEPQAVLLKITGVTRV
>gidB class=Sequence position=CP000031.2:1866..2480 (+ strand)
ATGATGGTTC CCGATGCGAA CACGCTCAAT GTTTCACGTG AAACATTCGA GCGGCTGAAA ATCTTTGCTG ATTTGGTGCA
CAAGTGGAAT CCCCGGATCA ACCTGGTATC CAAGCGTAGC CTGGAAGATC TGTGGACTCG TCACATAATC GATTCCATTC
AGGTGTTTCG CAACGCCCCG AAAGGTGATC TTTGGGTCGA TCTCGGCAGT GGTGGCGGGT TTCCAGGTTT GATCTGCGCT
ATTCTGGCTG CCGAAGAGAA ACCCGAAACC CAGTTTATCT GCGTTGAAAG CGATCAGCGA AAATCGGCGT TCCTGCGTAG
CGCTGCGCGC GAATGCGGCA TCGCATGTCA GGTGATATCC GAGCGTATCG AGCATCTTGA TCCGCTGGAC GCGGACATCC
TTTCCGCTCG GGCCTTGACC GATCTGACCG GTTTGCTGGG CTTTGCTGAA CGGCACCTCA AGATCGGCGG AACCGCGCTG
TTCCCCAAGG GGGCCGCATG GAAAAAAGAG CTGCAAGACG CCGCGAAGCA ATGGAATTTC TCCTACGACG CGGTTACTAG
TTTAACCGAG CCCCAGGCCG TTCTTTTGAA GATAACAGGA GTCACGCGTG TCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7