Roseobase: Ruegeria pomeroyi DSS-3

Name: gidB
Type: CDS
Description: identified by match to protein family HMM PF02527; match to protein family HMM TIGR00138; NCBI:; IMG:
Source: GenBank
Position: DSS3:1866..2480 (+ strand)
Length: 615
Dbxref: GI:56694930
  GeneID:3194097
Note: identified by match to protein family HMM PF02527; match to protein family HMM TIGR00138
  NCBI:
  IMG:
codon_start: 1
load_id: SPO0002.p01
locus_tag: SPO0002
parent_id: SPO0002.t01
product: glucose-inhibited division protein B
protein_id: REF_tigr:SPO0002
  YP_165275.1
transl_table: 11
translation: MMVPDANTLNVSRETFERLKIFADLVHKWNPRINLVSKRSLEDLWTRHIIDSIQVFRNAP KGDLWVDLGSGGGFPGLICAILAAEEKPETQFICVESDQRKSAFLRSAARECGIACQVIS ERIEHLDPLDADILSARALTDLTGLLGFAERHLKIGGTALFPKGAAWKKELQDAAKQWNF SYDAVTSLTEPQAVLLKITGVTRV
>gidB class=Sequence position=DSS3:1866..2480 (+ strand)
ATGATGGTTC CCGATGCGAA CACGCTCAAT GTTTCACGTG AAACATTCGA GCGGCTGAAA ATCTTTGCTG ATTTGGTGCA
CAAGTGGAAT CCCCGGATCA ACCTGGTATC CAAGCGTAGC CTGGAAGATC TGTGGACTCG TCACATAATC GATTCCATTC
AGGTGTTTCG CAACGCCCCG AAAGGTGATC TTTGGGTCGA TCTCGGCAGT GGTGGCGGGT TTCCAGGTTT GATCTGCGCT
ATTCTGGCTG CCGAAGAGAA ACCCGAAACC CAGTTTATCT GCGTTGAAAG CGATCAGCGA AAATCGGCGT TCCTGCGTAG
CGCTGCGCGC GAATGCGGCA TCGCATGTCA GGTGATATCC GAGCGTATCG AGCATCTTGA TCCGCTGGAC GCGGACATCC
TTTCCGCTCG GGCCTTGACC GATCTGACCG GTTTGCTGGG CTTTGCTGAA CGGCACCTCA AGATCGGCGG AACCGCGCTG
TTCCCCAAGG GGGCCGCATG GAAAAAAGAG CTGCAAGACG CCGCGAAGCA ATGGAATTTC TCCTACGACG CGGTTACTAG
TTTAACCGAG CCCCAGGCCG TTCTTTTGAA GATAACAGGA GTCACGCGTG TCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7