Roseobase: Ruegeria pomeroyi DSS-3

Name: glpK
Type: gene
Description:
Source: Genbank
Position: CP000031.2:106644..108122 (+ strand)
Length: 1479
gbkey: Gene
gene: glpK
gene_biotype: protein_coding
load_id: gene-SPO0104
locus_tag: SPO0104
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00370; match to protein family HMM PF02782; match to protein family HMM TIGR01311
Source: Genbank
Position: CP000031.2:106644..108122 (+ strand)
Length: 1479
Dbxref: NCBI_GP:AAV93435.1
IMG: glpK: glycerol kinase (EC 2.7.1.30)
Note: identified by match to protein family HMM PF00370; match to protein family HMM PF02782; match to protein family HMM TIGR01311
RefSeq: SPO_RS00525: glpK: glycerol kinase GlpK
gbkey: CDS
gene: glpK
load_id: cds-AAV93435.1
locus_tag: SPO0104
parent_id: gene-SPO0104
product: glycerol kinase
protein_id: AAV93435.1
transl_table: 11
translation: MTFILAIDQGTTSSRAILFDGEMRRVATAQREFTQHFPEAGWVEHDAEEIWQTTVEVCRE VIAGQGIGPEQIAGIGITNQRETTVVWDKAGGAPVHRAIVWQDRRTAAICERLRHAGCED DFTAQTGLLLDPYFSGTKVKWILDTVPGARDRAAAGELLFGTIDSFLIWRLTGGRVHASD ATNAARTLMFDIHQGEWSKDICELLDVPMSMLPEVRDCAADFGTTDLFGGQVPILGVAGD QQAATIGQACFQPGMMKSTYGTGCFALLNTGTQPVASQNRLLTTIAYQLDGQRTYALEGS IFIAGAAVQWLRDGLGIIENAAQSGALAARADPAQNVILVPAFTGLGAPYWKPDCRGAMF GLTRNSGPAEFCKAALESVAYQTRDLWEAMQGDWGADADVILRVDGGMSASDWAMQGLAD RLGAPVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAATWALDARFTPKMVEGDREAAYR RWKAAVAAAMMV
>glpK class=Sequence position=CP000031.2:106644..108122 (+ strand)
ATGACCTTTA TTCTGGCGAT CGACCAGGGC ACCACTTCGA GCCGGGCGAT CCTGTTCGAT GGCGAGATGC GGCGGGTGGC
GACCGCGCAG CGTGAATTCA CCCAGCATTT CCCCGAAGCG GGCTGGGTGG AACACGACGC CGAAGAGATC TGGCAAACGA
CGGTCGAGGT CTGCCGCGAG GTGATCGCCG GGCAGGGGAT CGGGCCCGAA CAGATCGCCG GGATCGGCAT CACCAACCAG
CGGGAAACCA CCGTGGTCTG GGACAAGGCC GGCGGTGCGC CCGTGCATCG CGCCATCGTC TGGCAGGACC GGCGCACCGC
TGCGATTTGT GAGCGGCTGC GCCATGCGGG GTGCGAGGAT GACTTTACCG CCCAGACCGG TCTGCTGCTG GACCCGTATT
TCTCGGGCAC CAAGGTGAAA TGGATCCTCG ACACCGTGCC GGGCGCGCGG GATCGCGCGG CGGCGGGCGA GCTGCTGTTC
GGCACCATCG ATTCGTTTTT GATCTGGCGG CTGACCGGTG GCCGGGTTCA TGCGAGTGAT GCGACCAACG CCGCGCGCAC
GCTGATGTTC GATATCCATC AGGGGGAATG GAGCAAGGAC ATCTGCGAGC TTCTTGACGT GCCGATGTCG ATGCTGCCCG
AGGTGCGCGA CTGCGCTGCC GATTTCGGCA CGACGGATCT GTTTGGCGGG CAGGTGCCGA TCCTGGGCGT TGCCGGCGAC
CAGCAGGCGG CCACCATCGG GCAGGCCTGT TTCCAGCCCG GCATGATGAA ATCCACCTAT GGCACCGGTT GTTTTGCGCT
GCTCAATACC GGGACACAGC CGGTCGCCTC GCAGAACCGG CTGCTGACGA CCATCGCCTA TCAGCTGGAC GGCCAGCGGA
CCTATGCGCT GGAAGGCTCG ATCTTCATTG CCGGGGCGGC GGTGCAGTGG CTGCGCGACG GGCTGGGTAT CATCGAGAAC
GCGGCGCAAA GCGGCGCGTT GGCGGCTCGC GCCGATCCGG CCCAGAATGT CATCCTGGTG CCCGCCTTTA CCGGTCTGGG
CGCCCCCTAT TGGAAGCCCG ATTGCCGGGG CGCAATGTTC GGGCTGACGC GCAACTCCGG TCCGGCCGAG TTCTGCAAGG
CGGCGCTGGA AAGCGTGGCC TATCAGACCC GCGATCTGTG GGAGGCGATG CAGGGCGATT GGGGTGCGGA TGCGGATGTG
ATCCTGCGTG TCGATGGCGG TATGAGCGCG TCCGACTGGG CGATGCAGGG CCTGGCCGAT CGTCTGGGCG CGCCGGTGGA
CCGCCCGGTG ATGCAGGAGA CCACGGCGCT GGGCGCGGCC TGGCTGGCCG GGATGCGGGC AGGGGTTTAC CCCGATCAGG
CAGGCTTTGC CGCGACCTGG GCGCTAGATG CCCGGTTCAC CCCCAAGATG GTCGAGGGCG ACCGCGAAGC CGCCTATCGC
CGCTGGAAAG CGGCAGTGGC GGCGGCGATG ATGGTCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7