Roseobase: Ruegeria pomeroyi DSS-3

Name: grpE
Type: gene
Description:
Source: Genbank
Position: CP000031.2:8205..8768 (+ strand)
Length: 564
gbkey: Gene
gene: grpE
gene_biotype: protein_coding
load_id: gene-SPO0010
locus_tag: SPO0010
Parts:
Type: CDS
Description: identified by match to protein family HMM PF01025
Source: Genbank
Position: CP000031.2:8205..8768 (+ strand)
Length: 564
Dbxref: NCBI_GP:AAV93341.1
IMG: grpE: co-chaperone GrpE
Note: identified by match to protein family HMM PF01025
RefSeq: SPO_RS00050: nucleotide exchange factor GrpE
gbkey: CDS
gene: grpE
load_id: cds-AAV93341.1
locus_tag: SPO0010
parent_id: gene-SPO0010
product: co-chaperone GrpE
protein_id: AAV93341.1
transl_table: 11
translation: MAKPNNEEFLDDIATAEAEELAEEMAEISDEAAELDTLRAERDAFKDKFMRALADAENVR KRGERARREAEQYGGSKLARDMLPVYDNMKRALETVTDEQRAVSGALIEGIELTMRALLD VFGKHGIQVLSPQVGDRFDPQMHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVG VSSMPAG
>grpE class=Sequence position=CP000031.2:8205..8768 (+ strand)
ATGGCAAAGC CGAACAACGA AGAGTTTCTG GACGATATCG CAACCGCCGA GGCCGAGGAA CTGGCCGAGG AGATGGCCGA
GATCAGCGAC GAGGCGGCAG AGCTGGATAC GCTGCGGGCC GAGCGGGATG CGTTCAAGGA CAAATTCATG CGCGCGCTGG
CAGATGCCGA GAACGTGCGC AAGCGGGGCG AACGCGCCCG GCGCGAGGCC GAGCAATATG GCGGTTCGAA ACTGGCCCGC
GACATGCTGC CGGTCTATGA CAACATGAAA CGCGCGCTGG AAACCGTGAC CGACGAACAG CGCGCGGTAT CGGGGGCGCT
GATCGAGGGC ATCGAACTGA CGATGCGGGC GCTGCTGGAT GTGTTCGGCA AGCATGGCAT CCAGGTGCTG TCGCCGCAGG
TGGGCGACCG GTTCGACCCG CAGATGCACG AAGCGATGTT CGAGGCGCCG GTGCCCGGCA CCAAGGCGGG CGATATCATC
CAGGTTTCGG CCGAAGGCTT CATGCTGCAC GACCGTCTGC TGCGCCCGGC GCAGGTCGGC GTATCGTCGA TGCCCGCGGG
CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7