Roseobase: Ruegeria pomeroyi DSS-3

Name: grpE
Type: CDS
Description: identified by match to protein family HMM PF01025; NCBI:nucleotide exchange factor GrpE; IMG:molecular chaperone GrpE
Source: GenBank
Position: DSS3:8205..8768 (+ strand)
Length: 564
Dbxref: GI:56694938
  GeneID:3195554
Note: identified by match to protein family HMM PF01025
  NCBI:nucleotide exchange factor GrpE
  IMG:molecular chaperone GrpE
codon_start: 1
load_id: SPO0010.p01
locus_tag: SPO0010
parent_id: SPO0010.t01
product: co-chaperone GrpE
protein_id: REF_tigr:SPO0010
  YP_165283.1
transl_table: 11
translation: MAKPNNEEFLDDIATAEAEELAEEMAEISDEAAELDTLRAERDAFKDKFMRALADAENVR KRGERARREAEQYGGSKLARDMLPVYDNMKRALETVTDEQRAVSGALIEGIELTMRALLD VFGKHGIQVLSPQVGDRFDPQMHEAMFEAPVPGTKAGDIIQVSAEGFMLHDRLLRPAQVG VSSMPAG
>grpE class=Sequence position=DSS3:8205..8768 (+ strand)
ATGGCAAAGC CGAACAACGA AGAGTTTCTG GACGATATCG CAACCGCCGA GGCCGAGGAA CTGGCCGAGG AGATGGCCGA
GATCAGCGAC GAGGCGGCAG AGCTGGATAC GCTGCGGGCC GAGCGGGATG CGTTCAAGGA CAAATTCATG CGCGCGCTGG
CAGATGCCGA GAACGTGCGC AAGCGGGGCG AACGCGCCCG GCGCGAGGCC GAGCAATATG GCGGTTCGAA ACTGGCCCGC
GACATGCTGC CGGTCTATGA CAACATGAAA CGCGCGCTGG AAACCGTGAC CGACGAACAG CGCGCGGTAT CGGGGGCGCT
GATCGAGGGC ATCGAACTGA CGATGCGGGC GCTGCTGGAT GTGTTCGGCA AGCATGGCAT CCAGGTGCTG TCGCCGCAGG
TGGGCGACCG GTTCGACCCG CAGATGCACG AAGCGATGTT CGAGGCGCCG GTGCCCGGCA CCAAGGCGGG CGATATCATC
CAGGTTTCGG CCGAAGGCTT CATGCTGCAC GACCGTCTGC TGCGCCCGGC GCAGGTCGGC GTATCGTCGA TGCCCGCGGG
CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7