Roseobase: Ruegeria pomeroyi DSS-3

Name: hemH
Type: CDS
Description: identified by match to protein family HMM PF00762; match to protein family HMM TIGR00109; NCBI:ferrochelatase; IMG:ferrochelatase
Source: GenBank
Position: DSS3:74429..75424 (+ strand)
Length: 996
Dbxref: GI:56695001
  GeneID:3192903
Note: identified by match to protein family HMM PF00762; match to protein family HMM TIGR00109
  NCBI:ferrochelatase
  IMG:ferrochelatase
codon_start: 1
eC_number: 4.99.1.1
load_id: SPO0073.p01
locus_tag: SPO0073
parent_id: SPO0073.t01
product: ferrochelatase
protein_id: REF_tigr:SPO0073
  YP_165347.1
transl_table: 11
translation: MGRVGVLLANLGTPDDYSYWPMRRYLNEFLSDKRVIDYPAWKWQPILQGIILTKRPFSSG AAYESIWNHDKGESPLMTITKDQTAKLRAALAERYGDRVMVDFCMRYGNPSTKSKVRQMV TEGCDRILFFPLYPQYAGATTATANDQFFRALMDETWQPAARTVPAYFDQPAYVDALAQS IERAYAAMDSRPDVLVCSYHGMPERYLMQGDPYHCQCVKTTRLLRERLGWDESEVVSTFQ SRFGPEEWLKPYTVDHVAELARQGKRNIAVVAPAFSADCIETLEEINEEIRESFEHAGGE RFTYIPCLNDEDAHIAALAGVVASNLGGWLD
>hemH class=Sequence position=DSS3:74429..75424 (+ strand)
ATGGGCCGCG TCGGCGTGTT GCTGGCCAAT CTCGGCACGC CTGACGACTA TTCCTATTGG CCGATGCGGC GCTATCTGAA
CGAGTTCCTG TCGGACAAGC GGGTGATCGA CTATCCGGCC TGGAAATGGC AGCCGATCCT GCAGGGCATC ATCCTGACCA
AGCGGCCGTT CAGCTCGGGT GCGGCCTATG AATCCATCTG GAATCACGAC AAGGGCGAAA GCCCGCTGAT GACGATCACC
AAGGACCAGA CCGCCAAGCT GCGCGCGGCG CTGGCCGAGC GCTATGGCGA CCGGGTGATG GTGGATTTCT GCATGCGCTA
CGGCAATCCC TCGACCAAGT CGAAGGTGCG CCAGATGGTG ACCGAGGGCT GCGACCGTAT CCTGTTCTTT CCGCTCTACC
CGCAATATGC CGGGGCGACG ACGGCAACGG CCAACGACCA GTTCTTTCGC GCGCTGATGG ACGAGACCTG GCAGCCCGCC
GCGCGTACCG TGCCGGCCTA TTTCGATCAG CCCGCCTATG TCGATGCGCT GGCGCAGTCG ATCGAACGGG CCTATGCGGC
GATGGACAGC CGCCCCGACG TGCTGGTCTG CTCGTATCAC GGCATGCCCG AGCGCTATCT GATGCAAGGC GACCCGTACC
ATTGCCAGTG CGTGAAAACC ACGCGACTGC TGCGCGAGCG GCTGGGCTGG GACGAGAGCG AGGTGGTATC GACCTTTCAG
TCGCGATTCG GCCCCGAAGA GTGGCTCAAA CCCTATACGG TCGACCACGT GGCCGAACTG GCGCGGCAGG GTAAGCGGAA
CATCGCGGTG GTGGCGCCGG CCTTTTCAGC CGATTGCATC GAGACGCTGG AAGAGATCAA CGAGGAAATC CGCGAGAGCT
TTGAACATGC GGGCGGTGAG CGGTTCACCT ATATCCCCTG CCTCAATGAC GAGGATGCCC ATATCGCGGC GCTGGCCGGT
GTGGTGGCAA GCAATCTGGG GGGCTGGCTG GACTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7