Roseobase: Ruegeria pomeroyi DSS-3

Name: hrcA
Type: gene
Description:
Source: Genbank
Position: CP000031.2:7130..8194 (+ strand)
Length: 1065
gbkey: Gene
gene: hrcA
gene_biotype: protein_coding
load_id: gene-SPO0009
locus_tag: SPO0009
Parts:
Type: CDS
Description: identified by similarity to SP:P54305; match to protein family HMM PF01628; match to protein family HMM TIGR00331
Source: Genbank
Position: CP000031.2:7130..8194 (+ strand)
Length: 1065
Dbxref: NCBI_GP:AAV93340.1
IMG: hrcA: heat-inducible transcription repressor HrcA
Note: identified by similarity to SP:P54305; match to protein family HMM PF01628; match to protein family HMM TIGR00331
RefSeq: SPO_RS00045: hrcA: heat-inducible transcriptional repressor HrcA
gbkey: CDS
gene: hrcA
load_id: cds-AAV93340.1
locus_tag: SPO0009
parent_id: gene-SPO0009
product: heat-inducible transcription repressor HrcA
protein_id: AAV93340.1
transl_table: 11
translation: MSDARKILDDLNDRSREVFRLIVESYLDSGEPVGSRTLTRTLSEKVSAATVRNVMQDLEF LGLLDSPHISAGRIPTQMGLRMFVDGLLEVADLSLDDRAKLDATLGTNAGDVGGTLDRIS ATLSRVTQGASLVLTPKHEAEIRHIEFVSLAQDRALVVLVFSDGHVENRLFAPPPGQTPS SMREAANFLNALIEGKTLSEVRRLMQTEIGARQQEIDQLARQMVESGLAVWDREGEEAAR LIVRGRANLLEGTGQEQELERIRVLFDDLERKRDIAEFLQLTEDGEGVRIFIGSENKLFS LSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVDYTAQLVGRLISDRS
>hrcA class=Sequence position=CP000031.2:7130..8194 (+ strand)
ATGAGCGATG CGCGCAAAAT ACTGGACGAT TTGAACGACC GCTCGCGCGA GGTGTTTCGC CTGATCGTTG AATCCTATCT
GGACAGCGGC GAACCGGTCG GCAGCCGCAC CCTGACGCGT ACACTCAGCG AGAAGGTCAG CGCCGCAACC GTGCGCAACG
TAATGCAGGA TCTGGAGTTC CTGGGCCTGC TCGACAGCCC CCATATCAGC GCCGGGCGTA TCCCGACGCA GATGGGGCTG
AGGATGTTTG TCGACGGGCT GCTCGAGGTG GCGGATCTGA GCCTGGATGA TCGGGCCAAG CTGGACGCGA CACTGGGCAC
AAACGCGGGC GACGTGGGCG GGACGCTGGA CCGGATCAGC GCCACGCTCA GCCGGGTGAC ACAGGGGGCC TCGTTGGTGC
TGACGCCCAA GCACGAGGCC GAAATCCGCC ATATCGAGTT TGTCTCGCTG GCGCAGGATC GGGCGTTGGT GGTGCTGGTC
TTTTCGGATG GCCATGTGGA AAACCGCCTG TTTGCGCCGC CCCCGGGGCA GACCCCCAGT TCGATGCGCG AGGCGGCCAA
TTTCCTGAAC GCGCTGATCG AGGGCAAGAC CCTCAGCGAG GTGCGCCGCC TGATGCAGAC CGAGATCGGC GCCCGCCAGC
AGGAAATCGA CCAGCTGGCC CGTCAGATGG TCGAAAGCGG TCTGGCGGTC TGGGACCGCG AGGGCGAAGA GGCCGCCCGG
CTGATCGTGC GCGGGCGGGC GAATCTGCTG GAGGGAACCG GCCAGGAACA AGAGCTGGAG CGGATCCGGG TGCTGTTCGA
CGATCTTGAG CGCAAGCGCG ACATCGCCGA GTTTCTGCAA CTGACCGAAG ACGGCGAAGG TGTGCGCATT TTTATCGGCT
CCGAGAACAA ACTTTTCTCA CTTTCGGGTT CCTCTTTGGT GGTGTCTCCA TATATGAACG CGGATCGAAA GGTTATCGGT
GCGGTGGGGG TGATCGGCCC GACGCGCCTG AACTATGGTC GCATCGTTCC GATCGTGGAT TACACGGCAC AGCTGGTCGG
GCGTCTGATT TCCGACCGGA GTTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7