Roseobase: Ruegeria pomeroyi DSS-3

Name: hslO
Type: gene
Description:
Source: GenBank
Position: DSS3:22858..23838 (+ strand)
Length: 981
Dbxref: GeneID:3194665
load_id: SPO0024
locus_tag: SPO0024
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:22858..23838 (+ strand)
Length: 981
load_id: SPO0024.t01
parent_id: SPO0024
Parts:
Type: CDS
Description: identified by similarity to SP:P45803; match to protein family HMM PF01430; NCBI:molecular chaperone Hsp33; IMG:molecular chaperone Hsp33
Source: GenBank
Position: DSS3:22858..23838 (+ strand)
Length: 981
Dbxref: GI:56694952
  GeneID:3194665
Note: identified by similarity to SP:P45803; match to protein family HMM PF01430
  NCBI:molecular chaperone Hsp33
  IMG:molecular chaperone Hsp33
codon_start: 1
load_id: SPO0024.p01
locus_tag: SPO0024
parent_id: SPO0024.t01
product: chaperonin, 33 kDa
protein_id: REF_tigr:SPO0024
  YP_165297.1
transl_table: 11
translation: MTLGTKIAWDDTVLPFQLDLPDMRGRVARLDGVLDGILKQHDYPTVVEALVAEMALLTAL IGQTIGLRWKLSLQVQSKGAVRMIATDYYAPRAEGEPARIRAYAGFDADRLTDGAPFDQV GEGYFAILIDQGKGTQPYQGITPLAGGSLSACAEAYFAQSEQLPTRFQLRFGKSTEPGVP EHWRAGGVMLQHMPKASPFAAGGPGTGDILTAADLVDGAEGENWNRVNILLDTVEDLELI GPALPPTDLLVRLFHEEQPRVYDAQSVRFGCTCSEERVRQSLSIYSVKDIGHMTTDEGTV TADCQFCGAHYVLDPASVGFEADQGD
Type: exon
Description:
Source: GenBank
Position: DSS3:22858..23838 (+ strand)
Length: 981
parent_id: SPO0024.t01
> class=Sequence position=DSS3:22858..23838 (+ strand)
ATGACACTCG GAACCAAAAT CGCGTGGGAC GACACTGTCC TGCCCTTTCA GCTCGATTTG CCTGACATGC GTGGCCGCGT
GGCGCGGCTG GACGGTGTGC TGGACGGCAT TCTGAAACAA CACGATTATC CCACAGTGGT CGAGGCCCTG GTGGCCGAAA
TGGCATTGCT GACCGCGCTG ATCGGCCAAA CCATCGGCCT GCGCTGGAAA CTGTCGCTGC AGGTACAGTC CAAGGGCGCG
GTGCGGATGA TCGCCACCGA TTACTATGCC CCTCGGGCCG AGGGCGAGCC GGCGCGCATC CGTGCCTATG CCGGTTTCGA
CGCCGACCGG CTGACCGACG GTGCCCCGTT CGATCAGGTG GGTGAGGGCT ATTTCGCGAT CCTGATCGAC CAGGGCAAAG
GGACCCAACC CTATCAGGGG ATCACCCCGC TGGCGGGTGG TTCGCTAAGC GCCTGTGCCG AGGCCTATTT TGCCCAATCC
GAACAGCTGC CGACACGGTT TCAGCTGCGC TTTGGCAAGT CCACCGAACC GGGCGTGCCA GAGCATTGGC GCGCCGGCGG
CGTGATGTTG CAGCATATGC CAAAGGCCTC GCCCTTTGCG GCGGGCGGAC CGGGAACGGG CGATATCCTG ACCGCCGCCG
ATCTGGTGGA CGGCGCCGAG GGCGAGAACT GGAACCGGGT CAATATCCTG CTCGACACGG TCGAGGACCT GGAGTTGATC
GGCCCGGCGC TGCCGCCGAC CGACCTGCTG GTGCGGCTGT TTCACGAGGA ACAGCCTCGT GTCTATGACG CGCAGTCGGT
GCGGTTTGGC TGCACCTGCT CCGAAGAGCG GGTGCGCCAG AGTCTGTCGA TCTACTCCGT CAAGGATATC GGCCACATGA
CCACCGACGA GGGTACAGTG ACCGCCGATT GCCAGTTCTG CGGCGCGCAT TACGTGTTGG ATCCGGCCTC GGTCGGGTTC
GAGGCGGATC AGGGTGACTG A
>hslO class=Sequence position=DSS3:22858..23838 (+ strand)
ATGACACTCG GAACCAAAAT CGCGTGGGAC GACACTGTCC TGCCCTTTCA GCTCGATTTG CCTGACATGC GTGGCCGCGT
GGCGCGGCTG GACGGTGTGC TGGACGGCAT TCTGAAACAA CACGATTATC CCACAGTGGT CGAGGCCCTG GTGGCCGAAA
TGGCATTGCT GACCGCGCTG ATCGGCCAAA CCATCGGCCT GCGCTGGAAA CTGTCGCTGC AGGTACAGTC CAAGGGCGCG
GTGCGGATGA TCGCCACCGA TTACTATGCC CCTCGGGCCG AGGGCGAGCC GGCGCGCATC CGTGCCTATG CCGGTTTCGA
CGCCGACCGG CTGACCGACG GTGCCCCGTT CGATCAGGTG GGTGAGGGCT ATTTCGCGAT CCTGATCGAC CAGGGCAAAG
GGACCCAACC CTATCAGGGG ATCACCCCGC TGGCGGGTGG TTCGCTAAGC GCCTGTGCCG AGGCCTATTT TGCCCAATCC
GAACAGCTGC CGACACGGTT TCAGCTGCGC TTTGGCAAGT CCACCGAACC GGGCGTGCCA GAGCATTGGC GCGCCGGCGG
CGTGATGTTG CAGCATATGC CAAAGGCCTC GCCCTTTGCG GCGGGCGGAC CGGGAACGGG CGATATCCTG ACCGCCGCCG
ATCTGGTGGA CGGCGCCGAG GGCGAGAACT GGAACCGGGT CAATATCCTG CTCGACACGG TCGAGGACCT GGAGTTGATC
GGCCCGGCGC TGCCGCCGAC CGACCTGCTG GTGCGGCTGT TTCACGAGGA ACAGCCTCGT GTCTATGACG CGCAGTCGGT
GCGGTTTGGC TGCACCTGCT CCGAAGAGCG GGTGCGCCAG AGTCTGTCGA TCTACTCCGT CAAGGATATC GGCCACATGA
CCACCGACGA GGGTACAGTG ACCGCCGATT GCCAGTTCTG CGGCGCGCAT TACGTGTTGG ATCCGGCCTC GGTCGGGTTC
GAGGCGGATC AGGGTGACTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7