Roseobase: Ruegeria pomeroyi DSS-3

Name: idi
Type: gene
Description:
Source: Genbank
Position: CP000031.2:137668..138210 (+ strand)
Length: 543
gbkey: Gene
gene: idi
gene_biotype: protein_coding
load_id: gene-SPO0131
locus_tag: SPO0131
Parts:
Type: CDS
Description: identified by similarity to SP:P26173; match to protein family HMM PF00293; match to protein family HMM TIGR02150
Source: Genbank
Position: CP000031.2:137668..138210 (+ strand)
Length: 543
Dbxref: NCBI_GP:AAV93459.1
IMG: idi: isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2)
Note: identified by similarity to SP:P26173; match to protein family HMM PF00293; match to protein family HMM TIGR02150
RefSeq: SPO_RS00670: idi: isopentenyl-diphosphate Delta-isomerase
gbkey: CDS
gene: idi
load_id: cds-AAV93459.1
locus_tag: SPO0131
parent_id: gene-SPO0131
product: isopentyl-diphosphate delta-isomerase
protein_id: AAV93459.1
transl_table: 11
translation: MGILIPAWVDDRLVPVDKLEAHEKGLKHKAVSVFAVRDMDILIQRRALGKYHTPGLWANT CCTHPDWDESASTCAVRRLREELGITGLYPEYRHRLEYHADVGNGMVENEVVDVFLAHVR GPLQVVPNPDEVMEIRWIGYHDLLAEVQRYPERFTPWLKIYLHHHADTIFGPDLIISAKA
>idi class=Sequence position=CP000031.2:137668..138210 (+ strand)
ATGGGCATCC TGATTCCGGC TTGGGTCGAC GATAGGCTTG TTCCGGTGGA CAAGCTCGAA GCGCATGAGA AGGGTCTGAA
ACACAAGGCG GTTTCGGTCT TTGCGGTGCG TGACATGGAC ATCCTGATCC AGCGCCGGGC GCTGGGCAAA TACCACACGC
CCGGCCTGTG GGCGAATACC TGCTGCACCC ATCCCGACTG GGACGAGAGC GCCTCGACCT GTGCGGTGCG GCGCCTGCGC
GAGGAGCTGG GGATCACCGG GCTTTATCCC GAGTACCGGC ACCGGCTTGA GTACCACGCG GACGTTGGCA ATGGCATGGT
CGAAAACGAG GTGGTGGATG TCTTCCTCGC CCATGTGCGT GGCCCGTTGC AGGTGGTGCC CAATCCCGAC GAGGTGATGG
AGATCCGCTG GATCGGCTAT CACGACCTGC TCGCCGAGGT GCAGCGCTAT CCCGAGCGGT TCACGCCCTG GCTCAAGATT
TATCTGCACC ACCATGCCGA CACCATCTTT GGCCCCGATC TGATCATCTC GGCCAAGGCC TGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7