Roseobase: Ruegeria pomeroyi DSS-3

Name: ilvA
Type: gene
Description:
Source: Genbank
Position: CP000031.2:19338..20564 (+ strand)
Length: 1227
gbkey: Gene
gene: ilvA
gene_biotype: protein_coding
load_id: gene-SPO0020
locus_tag: SPO0020
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00291; match to protein family HMM PF00585; match to protein family HMM TIGR02079
Source: Genbank
Position: CP000031.2:19338..20564 (+ strand)
Length: 1227
Dbxref: NCBI_GP:AAV93351.1
IMG: ilvA: L-threonine ammonia-lyase (EC 4.3.1.19)
Note: identified by match to protein family HMM PF00291; match to protein family HMM PF00585; match to protein family HMM TIGR02079
RefSeq: SPO_RS00100: ilvA: threonine ammonia-lyase IlvA
gbkey: CDS
gene: ilvA
load_id: cds-AAV93351.1
locus_tag: SPO0020
parent_id: gene-SPO0020
product: threonine dehydratase
protein_id: AAV93351.1
transl_table: 11
translation: MSDFMTRARAAEQAMREVFPATPLQRNDHLSARYGADIWLKREDLSPVRSYKIRGAFNAM RKQPGQGLFVCASAGNHAQGVAFMCRHMGVRGVIFMPVTTPQQKIQKTRMFGGDQVEIHL TGDYFDQTLAAAQAWCAQEGGHFLSPFDDADVIEGQASLAVEIEEQLGGVPDHVVLPVGG GGMSAGVATWFGDRSHCIFVEPEGGACLRAALAAGHPVKLDHVDNFVDGAAVGRIGEKTF ELLKSRHMSDVLVMPEDRICTTIIEMLNVEGIVLEPAGALSVEAVADVQSFVRGKTVVCV TSGGNFDFERLPEVKERAQRYLGVKKYFLLRLPQRPGALKEFLNILGPDDDIARFEYMKK SARNFGSVLIGIETARPENFERLYARLDEAGFTYTDITRNETLAQFVI
>ilvA class=Sequence position=CP000031.2:19338..20564 (+ strand)
ATGAGCGATT TCATGACCCG AGCCCGCGCC GCCGAACAGG CGATGCGCGA AGTTTTCCCC GCCACGCCGT TGCAGCGAAA
CGACCATCTG TCGGCGCGTT ATGGCGCCGA TATCTGGCTT AAGCGCGAGG ATCTGAGCCC GGTCCGCTCC TACAAGATCC
GAGGTGCGTT CAACGCGATG CGCAAGCAGC CGGGGCAGGG GCTGTTCGTC TGTGCAAGTG CCGGCAATCA TGCCCAGGGC
GTGGCCTTTA TGTGTCGGCA CATGGGGGTA CGGGGCGTGA TCTTCATGCC GGTGACCACG CCGCAGCAGA AGATCCAGAA
GACCCGCATG TTCGGCGGCG ATCAGGTCGA AATTCACCTG ACCGGCGACT ATTTCGACCA GACGCTGGCC GCCGCACAGG
CCTGGTGCGC GCAGGAGGGT GGGCATTTCC TGTCGCCCTT CGACGATGCC GATGTGATCG AGGGGCAGGC CTCGCTGGCC
GTCGAGATCG AGGAACAGCT GGGCGGCGTG CCCGATCATG TGGTGCTGCC GGTGGGTGGC GGCGGCATGT CGGCGGGGGT
GGCGACCTGG TTCGGGGATC GCAGCCATTG CATCTTTGTC GAACCCGAGG GCGGCGCCTG CCTGCGCGCG GCGCTGGCGG
CGGGGCATCC GGTAAAGCTG GATCATGTGG ACAATTTCGT CGATGGCGCG GCGGTGGGCC GGATCGGGGA AAAGACATTC
GAACTGCTGA AATCGCGGCA CATGTCCGAT GTGCTGGTGA TGCCCGAAGA TCGCATCTGC ACCACCATCA TCGAGATGCT
GAATGTCGAG GGGATCGTGC TGGAACCCGC CGGCGCGCTG TCGGTCGAGG CGGTGGCCGA TGTGCAAAGC TTTGTCCGGG
GCAAGACGGT GGTCTGCGTC ACCTCGGGCG GCAATTTCGA TTTCGAACGC CTGCCCGAGG TCAAGGAGCG CGCGCAGCGC
TATTTGGGGG TCAAGAAATA CTTCCTGCTG CGCCTGCCAC AGCGACCGGG CGCGCTGAAG GAATTTCTGA ACATTCTGGG
GCCCGATGAC GATATCGCCC GGTTCGAATA CATGAAGAAA TCGGCGCGCA ATTTCGGCTC GGTCCTGATC GGGATCGAAA
CCGCGAGGCC CGAGAACTTC GAACGCCTTT ACGCCCGTCT GGACGAGGCC GGGTTTACCT ATACCGATAT CACCCGCAAC
GAGACGCTGG CGCAATTCGT GATCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7