Roseobase: Ruegeria pomeroyi DSS-3

Name: infB
Type: gene
Description:
Source: GenBank
Position: DSS3:62848..65355 (- strand)
Length: 2508
Dbxref: GeneID:3193823
load_id: SPO0061
locus_tag: SPO0061
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:62848..65355 (- strand)
Length: 2508
load_id: SPO0061.t01
parent_id: SPO0061
Parts:
Type: CDS
Description: identified by similarity to SP:P02995; match to protein family HMM PF00009; match to protein family HMM PF03144; match to protein family HMM PF04760; match to protein family HMM TIGR00231; match to protein family HMM TIGR00487; NCBI:translation initiation factor IF-2; IMG:bacterial translation initiation factor 2 (bIF-2)
Source: GenBank
Position: DSS3:62848..65355 (- strand)
Length: 2508
Dbxref: GI:56694989
  GeneID:3193823
Note: identified by similarity to SP:P02995; match to protein family HMM PF00009; match to protein family HMM PF03144; match to protein family HMM PF04760; match to protein family HMM TIGR00231; match to protein family HMM TIGR00487
  NCBI:translation initiation factor IF-2
  IMG:bacterial translation initiation factor 2 (bIF-2)
codon_start: 1
load_id: SPO0061.p01
locus_tag: SPO0061
parent_id: SPO0061.t01
product: translation initiation factor IF-2
protein_id: REF_tigr:SPO0061
  YP_165335.1
transl_table: 11
translation: MSDTDGKKTLGLRGSRPGNVKQSFSHGRTKNVVVETKRKRVVVPKPGAGKPSAGGSSPAG DPSRRPAGISDAEMERRLNALKAAKARESEEAAQREAEEKARAEERERRRAEQEAKEREQ REAEQRAREKAEEEERQRREAEEEAKRAAVRAAAEQEAPKAERSAERAPAAARPEGGDNA RRTTDRDREREQRQTRGKGRQDGRRSGKLTLSQVTDGEGGRQKSLAAMKRKQERARQKAM GGAAEREKVIREVQLPEAIVVSELANRMAERVADVVKELMKMGMMVTQNQTIDADTAELI IEEFGHKVVRVSDSDVEDVISDIEDAEEDLKPRPPVITIMGHVDHGKTSLLDAIRDAKVV AGEAGGITQHIGAYQVKTDGGATLSFLDTPGHAAFTSMRSRGAQVTDIVVLVVAADDAVM PQTVEAINHAKAAGVPMIVAINKIDKPEANPTKVRTDLLQHEVVVEAMSGEVQDVEVSAK TGEGLDELLEAIALQAEILELKANPDRPAQGAVIEAQLDVGRGPVATVLIQKGTLRQGDI FVVGEQYGKVRALINDKGERVSEAGPSVPVEVLGLNGTPEAGDVLNVTSTEAQAREIAEY RAQVAKDKRAAAGAATTLEQLMAKAKADENVAELPILVKADVQGSAEAIVQAMEKIGNDE VRVRVLHSGVGAITETDVGLAEASGAPIMGFNVRANASARNTANQKGVEIRYYSVIYDLV DDVKAAASGLLSAEIRENFIGYANIKEVFKVSNVGKVAGCLVTEGVARRSAGVRLLRDNV VIHEGTLKTLKRFKDEVAEVQSGQECGMAFENYDDIRPGDVIEIFEREEVTRTLT
Type: exon
Description:
Source: GenBank
Position: DSS3:62848..65355 (- strand)
Length: 2508
parent_id: SPO0061.t01
> class=Sequence position=DSS3:62848..65355 (- strand)
ATGAGCGATA CTGACGGCAA AAAGACATTG GGTCTGCGTG GTTCCCGCCC CGGGAATGTG AAACAGAGTT TCAGCCACGG
ACGGACCAAG AATGTCGTGG TGGAAACCAA GCGCAAGCGC GTGGTGGTCC CCAAGCCCGG TGCCGGAAAG CCCAGCGCCG
GCGGCTCCTC GCCGGCCGGA GACCCTTCGC GCCGTCCCGC AGGGATTTCC GACGCCGAGA TGGAGCGCCG GCTGAACGCG
CTCAAGGCCG CCAAGGCCCG CGAGTCCGAA GAAGCCGCGC AGCGCGAGGC CGAGGAAAAG GCGCGCGCCG AAGAGCGCGA
ACGCCGCCGG GCCGAGCAAG AGGCCAAGGA ACGCGAACAG CGCGAGGCCG AACAGCGCGC CCGTGAAAAG GCCGAGGAAG
AAGAGCGCCA GCGCCGCGAG GCCGAAGAGG AGGCCAAGCG CGCCGCCGTG CGTGCCGCGG CCGAGCAGGA AGCGCCGAAA
GCCGAACGCA GCGCCGAGCG CGCTCCGGCT GCCGCGCGCC CCGAGGGTGG CGACAATGCC CGCCGCACCA CGGATCGCGA
TCGCGAACGC GAGCAGCGCC AGACCCGCGG CAAGGGCCGT CAGGACGGCC GCCGCTCGGG CAAGCTGACG CTCAGCCAGG
TTACCGACGG TGAAGGCGGG CGCCAGAAAT CGCTCGCCGC GATGAAGCGC AAGCAGGAAC GCGCCCGGCA AAAGGCCATG
GGTGGCGCCG CCGAGCGTGA AAAGGTCATC CGCGAAGTTC AGCTGCCCGA AGCCATTGTG GTTTCCGAGC TTGCCAACCG
CATGGCCGAA CGCGTGGCCG ATGTGGTCAA GGAACTGATG AAAATGGGCA TGATGGTCAC CCAGAACCAG ACCATCGACG
CCGACACCGC CGAACTGATC ATCGAGGAAT TCGGCCACAA GGTCGTCCGG GTCTCGGATT CCGACGTCGA AGATGTCATC
TCCGATATCG AGGACGCCGA AGAAGACCTC AAGCCGCGTC CGCCGGTCAT CACCATCATG GGTCACGTCG ACCACGGCAA
AACCTCGCTT CTGGATGCCA TCCGCGACGC CAAGGTTGTT GCGGGCGAGG CCGGTGGCAT CACCCAGCAT ATCGGTGCCT
ATCAGGTCAA AACCGATGGC GGCGCAACGC TGAGCTTCCT CGATACGCCG GGCCACGCGG CCTTTACCTC GATGCGCTCG
CGCGGTGCTC AGGTGACCGA TATCGTGGTT CTGGTTGTCG CTGCCGATGA CGCGGTGATG CCGCAGACCG TCGAGGCGAT
CAACCACGCC AAGGCAGCCG GTGTGCCGAT GATCGTGGCG ATCAACAAGA TCGACAAACC CGAGGCGAAC CCGACCAAGG
TGCGCACCGA CCTGCTGCAA CACGAAGTTG TGGTCGAGGC GATGTCGGGC GAAGTGCAGG ATGTCGAAGT TTCGGCCAAG
ACTGGCGAAG GTCTGGACGA GCTGCTCGAA GCGATCGCAC TGCAGGCCGA AATCCTGGAG CTGAAGGCCA ATCCCGACCG
TCCGGCACAG GGCGCGGTGA TCGAGGCGCA GCTGGATGTG GGTCGTGGCC CGGTCGCCAC CGTTCTGATC CAGAAGGGCA
CGCTGCGCCA GGGCGACATC TTTGTCGTGG GCGAGCAATA CGGCAAGGTT CGCGCCCTGA TCAACGACAA GGGCGAGCGC
GTGAGCGAAG CCGGCCCCTC GGTTCCGGTC GAGGTTCTGG GTCTCAACGG CACGCCTGAG GCGGGTGACG TTCTGAACGT
GACCTCGACC GAGGCGCAGG CCCGCGAGAT CGCGGAATAC CGCGCTCAGG TCGCCAAGGA CAAGCGCGCC GCCGCCGGTG
CAGCCACCAC GCTGGAACAG CTGATGGCCA AGGCCAAGGC CGACGAGAAT GTCGCCGAGC TGCCGATCCT GGTGAAGGCC
GACGTGCAGG GCTCTGCCGA GGCGATCGTT CAGGCGATGG AAAAGATCGG CAACGACGAG GTACGCGTAC GCGTGCTGCA
TTCGGGCGTC GGTGCCATCA CCGAAACCGA TGTGGGCCTC GCCGAGGCCT CGGGCGCGCC GATCATGGGC TTCAACGTCC
GAGCCAATGC GTCTGCCCGT AACACCGCTA ACCAGAAGGG CGTCGAAATC CGGTACTATT CGGTGATCTA CGACCTGGTC
GACGATGTGA AAGCGGCGGC CAGCGGCCTG CTGAGCGCCG AAATCCGCGA GAACTTCATC GGTTACGCGA ATATCAAGGA
AGTCTTCAAG GTCTCCAACG TCGGCAAGGT CGCCGGCTGT CTGGTCACCG AAGGCGTCGC CCGCCGCTCG GCCGGTGTGC
GCCTGCTGCG CGACAACGTG GTGATCCACG AAGGCACGCT CAAGACCCTC AAACGCTTCA AGGACGAAGT GGCCGAGGTT
CAGTCTGGCC AGGAATGCGG CATGGCTTTC GAGAACTACG ACGATATCCG CCCCGGCGAT GTGATCGAGA TTTTCGAACG
CGAGGAAGTG ACGCGGACGC TGACCTGA
>infB class=Sequence position=DSS3:62848..65355 (- strand)
ATGAGCGATA CTGACGGCAA AAAGACATTG GGTCTGCGTG GTTCCCGCCC CGGGAATGTG AAACAGAGTT TCAGCCACGG
ACGGACCAAG AATGTCGTGG TGGAAACCAA GCGCAAGCGC GTGGTGGTCC CCAAGCCCGG TGCCGGAAAG CCCAGCGCCG
GCGGCTCCTC GCCGGCCGGA GACCCTTCGC GCCGTCCCGC AGGGATTTCC GACGCCGAGA TGGAGCGCCG GCTGAACGCG
CTCAAGGCCG CCAAGGCCCG CGAGTCCGAA GAAGCCGCGC AGCGCGAGGC CGAGGAAAAG GCGCGCGCCG AAGAGCGCGA
ACGCCGCCGG GCCGAGCAAG AGGCCAAGGA ACGCGAACAG CGCGAGGCCG AACAGCGCGC CCGTGAAAAG GCCGAGGAAG
AAGAGCGCCA GCGCCGCGAG GCCGAAGAGG AGGCCAAGCG CGCCGCCGTG CGTGCCGCGG CCGAGCAGGA AGCGCCGAAA
GCCGAACGCA GCGCCGAGCG CGCTCCGGCT GCCGCGCGCC CCGAGGGTGG CGACAATGCC CGCCGCACCA CGGATCGCGA
TCGCGAACGC GAGCAGCGCC AGACCCGCGG CAAGGGCCGT CAGGACGGCC GCCGCTCGGG CAAGCTGACG CTCAGCCAGG
TTACCGACGG TGAAGGCGGG CGCCAGAAAT CGCTCGCCGC GATGAAGCGC AAGCAGGAAC GCGCCCGGCA AAAGGCCATG
GGTGGCGCCG CCGAGCGTGA AAAGGTCATC CGCGAAGTTC AGCTGCCCGA AGCCATTGTG GTTTCCGAGC TTGCCAACCG
CATGGCCGAA CGCGTGGCCG ATGTGGTCAA GGAACTGATG AAAATGGGCA TGATGGTCAC CCAGAACCAG ACCATCGACG
CCGACACCGC CGAACTGATC ATCGAGGAAT TCGGCCACAA GGTCGTCCGG GTCTCGGATT CCGACGTCGA AGATGTCATC
TCCGATATCG AGGACGCCGA AGAAGACCTC AAGCCGCGTC CGCCGGTCAT CACCATCATG GGTCACGTCG ACCACGGCAA
AACCTCGCTT CTGGATGCCA TCCGCGACGC CAAGGTTGTT GCGGGCGAGG CCGGTGGCAT CACCCAGCAT ATCGGTGCCT
ATCAGGTCAA AACCGATGGC GGCGCAACGC TGAGCTTCCT CGATACGCCG GGCCACGCGG CCTTTACCTC GATGCGCTCG
CGCGGTGCTC AGGTGACCGA TATCGTGGTT CTGGTTGTCG CTGCCGATGA CGCGGTGATG CCGCAGACCG TCGAGGCGAT
CAACCACGCC AAGGCAGCCG GTGTGCCGAT GATCGTGGCG ATCAACAAGA TCGACAAACC CGAGGCGAAC CCGACCAAGG
TGCGCACCGA CCTGCTGCAA CACGAAGTTG TGGTCGAGGC GATGTCGGGC GAAGTGCAGG ATGTCGAAGT TTCGGCCAAG
ACTGGCGAAG GTCTGGACGA GCTGCTCGAA GCGATCGCAC TGCAGGCCGA AATCCTGGAG CTGAAGGCCA ATCCCGACCG
TCCGGCACAG GGCGCGGTGA TCGAGGCGCA GCTGGATGTG GGTCGTGGCC CGGTCGCCAC CGTTCTGATC CAGAAGGGCA
CGCTGCGCCA GGGCGACATC TTTGTCGTGG GCGAGCAATA CGGCAAGGTT CGCGCCCTGA TCAACGACAA GGGCGAGCGC
GTGAGCGAAG CCGGCCCCTC GGTTCCGGTC GAGGTTCTGG GTCTCAACGG CACGCCTGAG GCGGGTGACG TTCTGAACGT
GACCTCGACC GAGGCGCAGG CCCGCGAGAT CGCGGAATAC CGCGCTCAGG TCGCCAAGGA CAAGCGCGCC GCCGCCGGTG
CAGCCACCAC GCTGGAACAG CTGATGGCCA AGGCCAAGGC CGACGAGAAT GTCGCCGAGC TGCCGATCCT GGTGAAGGCC
GACGTGCAGG GCTCTGCCGA GGCGATCGTT CAGGCGATGG AAAAGATCGG CAACGACGAG GTACGCGTAC GCGTGCTGCA
TTCGGGCGTC GGTGCCATCA CCGAAACCGA TGTGGGCCTC GCCGAGGCCT CGGGCGCGCC GATCATGGGC TTCAACGTCC
GAGCCAATGC GTCTGCCCGT AACACCGCTA ACCAGAAGGG CGTCGAAATC CGGTACTATT CGGTGATCTA CGACCTGGTC
GACGATGTGA AAGCGGCGGC CAGCGGCCTG CTGAGCGCCG AAATCCGCGA GAACTTCATC GGTTACGCGA ATATCAAGGA
AGTCTTCAAG GTCTCCAACG TCGGCAAGGT CGCCGGCTGT CTGGTCACCG AAGGCGTCGC CCGCCGCTCG GCCGGTGTGC
GCCTGCTGCG CGACAACGTG GTGATCCACG AAGGCACGCT CAAGACCCTC AAACGCTTCA AGGACGAAGT GGCCGAGGTT
CAGTCTGGCC AGGAATGCGG CATGGCTTTC GAGAACTACG ACGATATCCG CCCCGGCGAT GTGATCGAGA TTTTCGAACG
CGAGGAAGTG ACGCGGACGC TGACCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7