Roseobase: Ruegeria pomeroyi DSS-3

Name: kdsB
Type: gene
Description:
Source: GenBank
Position: DSS3:38766..39566 (- strand)
Length: 801
Dbxref: GeneID:3196170
load_id: SPO0038
locus_tag: SPO0038
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:38766..39566 (- strand)
Length: 801
load_id: SPO0038.t01
parent_id: SPO0038
Parts:
Type: CDS
Description: identified by match to protein family HMM PF02348; NCBI:3-deoxy-manno-octulosonate cytidylyltransferase; IMG:3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase)
Source: GenBank
Position: DSS3:38766..39566 (- strand)
Length: 801
Dbxref: GI:56694966
  GeneID:3196170
Note: identified by match to protein family HMM PF02348
  NCBI:3-deoxy-manno-octulosonate cytidylyltransferase
  IMG:3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase)
codon_start: 1
eC_number: 2.7.7.38
load_id: SPO0038.p01
locus_tag: SPO0038
parent_id: SPO0038.t01
product: 3-deoxy-D-manno-octulosonate cytidylyltransferase
protein_id: REF_tigr:SPO0038
  YP_165311.1
transl_table: 11
translation: MSVLIAIPARYASTRYPGKPLVSLTGASGTEMTLIERSWRAAMAVSGADRVVVATDDDRI RAVAEGFGAEVVMTSSDCVNGTERCAEAHAVLGGGFDIVVNLQGDAPLTPHWFVEDLIAG LRAAPEADIATPVLRCDGMALNGFLNDRKHGRVGGTTAVFAADRSALYFSKEVIPFTSQI YADDAPTPVFHHVGVYAYRPGALADYPTWPMGPLETLEGLEQLRFMENGRKVLCVEVEAR GRQFWELNNPEDVARIEEMMAAMGLD
Type: exon
Description:
Source: GenBank
Position: DSS3:38766..39566 (- strand)
Length: 801
parent_id: SPO0038.t01
> class=Sequence position=DSS3:38766..39566 (- strand)
ATGTCCGTCC TCATCGCCAT TCCCGCCCGC TATGCCTCGA CCCGCTATCC CGGCAAGCCG CTGGTCAGCC TGACCGGCGC
CAGTGGCACG GAAATGACGC TGATCGAACG CTCGTGGCGG GCGGCGATGG CGGTGAGCGG CGCCGACCGG GTGGTGGTCG
CCACCGATGA CGACCGCATC CGCGCGGTGG CCGAAGGCTT CGGGGCCGAG GTCGTCATGA CCTCGTCAGA TTGCGTCAAC
GGGACCGAGC GCTGCGCCGA GGCACATGCG GTGCTGGGTG GCGGTTTCGA CATCGTGGTG AACCTGCAGG GCGATGCGCC
GCTGACCCCG CACTGGTTTG TCGAGGATCT GATCGCGGGC CTGCGCGCCG CGCCCGAGGC CGATATCGCA ACACCGGTGC
TGCGCTGTGA CGGCATGGCG CTGAACGGGT TTCTGAACGA TCGCAAACAT GGCCGGGTTG GTGGCACCAC GGCGGTGTTC
GCGGCCGACC GCAGCGCGCT CTATTTCTCC AAGGAGGTGA TCCCCTTCAC CTCGCAGATC TATGCCGATG ACGCACCCAC
TCCGGTGTTC CACCATGTCG GCGTCTATGC CTATCGGCCT GGCGCGCTGG CGGATTATCC GACCTGGCCG ATGGGGCCGC
TGGAAACGCT CGAAGGGCTG GAACAGCTGC GTTTCATGGA AAACGGGCGC AAGGTTCTGT GTGTCGAGGT CGAGGCGCGC
GGGCGCCAGT TCTGGGAGCT GAACAACCCC GAGGACGTGG CCCGGATCGA AGAGATGATG GCCGCGATGG GGCTGGACTG
A
>kdsB class=Sequence position=DSS3:38766..39566 (- strand)
ATGTCCGTCC TCATCGCCAT TCCCGCCCGC TATGCCTCGA CCCGCTATCC CGGCAAGCCG CTGGTCAGCC TGACCGGCGC
CAGTGGCACG GAAATGACGC TGATCGAACG CTCGTGGCGG GCGGCGATGG CGGTGAGCGG CGCCGACCGG GTGGTGGTCG
CCACCGATGA CGACCGCATC CGCGCGGTGG CCGAAGGCTT CGGGGCCGAG GTCGTCATGA CCTCGTCAGA TTGCGTCAAC
GGGACCGAGC GCTGCGCCGA GGCACATGCG GTGCTGGGTG GCGGTTTCGA CATCGTGGTG AACCTGCAGG GCGATGCGCC
GCTGACCCCG CACTGGTTTG TCGAGGATCT GATCGCGGGC CTGCGCGCCG CGCCCGAGGC CGATATCGCA ACACCGGTGC
TGCGCTGTGA CGGCATGGCG CTGAACGGGT TTCTGAACGA TCGCAAACAT GGCCGGGTTG GTGGCACCAC GGCGGTGTTC
GCGGCCGACC GCAGCGCGCT CTATTTCTCC AAGGAGGTGA TCCCCTTCAC CTCGCAGATC TATGCCGATG ACGCACCCAC
TCCGGTGTTC CACCATGTCG GCGTCTATGC CTATCGGCCT GGCGCGCTGG CGGATTATCC GACCTGGCCG ATGGGGCCGC
TGGAAACGCT CGAAGGGCTG GAACAGCTGC GTTTCATGGA AAACGGGCGC AAGGTTCTGT GTGTCGAGGT CGAGGCGCGC
GGGCGCCAGT TCTGGGAGCT GAACAACCCC GAGGACGTGG CCCGGATCGA AGAGATGATG GCCGCGATGG GGCTGGACTG
A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7