Roseobase: Ruegeria pomeroyi DSS-3

Name: kdsD
Type: gene
Description:
Source: GenBank
Position: DSS3:80401..81369 (- strand)
Length: 969
Dbxref: GeneID:3196256
load_id: SPO0082
locus_tag: SPO0082
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:80401..81369 (- strand)
Length: 969
load_id: SPO0082.t01
parent_id: SPO0082
Parts:
Type: CDS
Description: identified by similarity to SP:P45395; match to protein family HMM PF00571; match to protein family HMM PF01380; match to protein family HMM TIGR00393; NCBI:arabinose-5-phosphate isomerase; IMG:arabinose-5-phosphate isomerase
Source: GenBank
Position: DSS3:80401..81369 (- strand)
Length: 969
Dbxref: GI:56695011
  GeneID:3196256
Note: identified by similarity to SP:P45395; match to protein family HMM PF00571; match to protein family HMM PF01380; match to protein family HMM TIGR00393
  NCBI:arabinose-5-phosphate isomerase
  IMG:arabinose-5-phosphate isomerase
codon_start: 1
eC_number: 5.3.1.13
load_id: SPO0082.p01
locus_tag: SPO0082
parent_id: SPO0082.t01
product: arabinose 5-phosphate isomerase
protein_id: REF_tigr:SPO0082
  YP_165356.1
transl_table: 11
translation: MTDRSSFIDTARQVVLDEARALDALSESLGDGFAEAVELILRTKGRVIVSGIGKSGHIGH KIAATLASTGTPAYFVHPAEASHGDLGMLSGDDVVLAISNSGEAPELANLLAFTRRFAIP LIGLSSKSESSLMQQADVHLLIPALGEACGFGMVPSISTTLTLAMGDALAIALMKYRDFR PENFRVFHPGGKLGARLSRVSDLMHGGEAVPLIAADTPMSEALLEISRKGFGVVGVTDGA GHLAGIVTDGDLRRHMSGLLDKTAAQVMTANPTTIAPDSLAEEAVAIMNARKITSLFVVD PAEPGVARGLLHIHDCLRVGLG
Type: exon
Description:
Source: GenBank
Position: DSS3:80401..81369 (- strand)
Length: 969
parent_id: SPO0082.t01
> class=Sequence position=DSS3:80401..81369 (- strand)
ATGACCGATC GCAGCTCTTT CATCGACACC GCACGCCAGG TCGTGCTGGA CGAGGCCCGG GCGCTTGATG CGCTGTCCGA
GAGCCTGGGC GACGGGTTCG CCGAGGCGGT GGAGCTGATC CTGCGCACCA AGGGGCGCGT GATCGTTTCG GGCATTGGCA
AGTCGGGCCA TATCGGCCAC AAGATCGCCG CGACGCTGGC CAGCACCGGC ACGCCCGCCT ATTTCGTGCA CCCGGCCGAG
GCGAGCCATG GCGATCTGGG AATGCTCTCC GGGGATGACG TGGTTCTGGC CATCTCGAAC TCGGGCGAGG CGCCGGAACT
GGCCAATCTG CTGGCCTTTA CCCGCCGCTT CGCCATTCCG CTGATCGGGC TGTCGAGCAA ATCTGAGAGC TCGCTGATGC
AGCAGGCCGA TGTGCATCTG CTGATCCCGG CGCTGGGCGA GGCCTGCGGC TTTGGCATGG TGCCGTCGAT CTCGACCACG
CTGACGCTGG CCATGGGCGA CGCACTGGCC ATCGCGCTGA TGAAGTACCG CGATTTCCGG CCCGAGAACT TCCGCGTCTT
CCATCCCGGC GGCAAGCTGG GCGCGCGGCT CAGCCGGGTG TCAGACCTGA TGCATGGCGG CGAGGCGGTA CCGTTGATCG
CCGCCGACAC CCCGATGAGC GAGGCGCTGC TGGAGATTAG CCGCAAGGGG TTTGGCGTGG TCGGCGTGAC CGATGGCGCC
GGACATCTGG CCGGAATCGT CACCGATGGC GACCTGCGTC GTCACATGTC GGGCCTGCTC GACAAGACCG CCGCCCAGGT
GATGACCGCC AACCCGACCA CCATCGCCCC CGACTCGCTG GCCGAGGAAG CGGTGGCTAT CATGAACGCG CGCAAGATCA
CCTCGCTTTT CGTGGTCGAT CCGGCGGAAC CGGGCGTGGC GCGCGGGCTG CTGCATATCC ACGACTGTCT GCGCGTCGGA
CTGGGCTAG
>kdsD class=Sequence position=DSS3:80401..81369 (- strand)
ATGACCGATC GCAGCTCTTT CATCGACACC GCACGCCAGG TCGTGCTGGA CGAGGCCCGG GCGCTTGATG CGCTGTCCGA
GAGCCTGGGC GACGGGTTCG CCGAGGCGGT GGAGCTGATC CTGCGCACCA AGGGGCGCGT GATCGTTTCG GGCATTGGCA
AGTCGGGCCA TATCGGCCAC AAGATCGCCG CGACGCTGGC CAGCACCGGC ACGCCCGCCT ATTTCGTGCA CCCGGCCGAG
GCGAGCCATG GCGATCTGGG AATGCTCTCC GGGGATGACG TGGTTCTGGC CATCTCGAAC TCGGGCGAGG CGCCGGAACT
GGCCAATCTG CTGGCCTTTA CCCGCCGCTT CGCCATTCCG CTGATCGGGC TGTCGAGCAA ATCTGAGAGC TCGCTGATGC
AGCAGGCCGA TGTGCATCTG CTGATCCCGG CGCTGGGCGA GGCCTGCGGC TTTGGCATGG TGCCGTCGAT CTCGACCACG
CTGACGCTGG CCATGGGCGA CGCACTGGCC ATCGCGCTGA TGAAGTACCG CGATTTCCGG CCCGAGAACT TCCGCGTCTT
CCATCCCGGC GGCAAGCTGG GCGCGCGGCT CAGCCGGGTG TCAGACCTGA TGCATGGCGG CGAGGCGGTA CCGTTGATCG
CCGCCGACAC CCCGATGAGC GAGGCGCTGC TGGAGATTAG CCGCAAGGGG TTTGGCGTGG TCGGCGTGAC CGATGGCGCC
GGACATCTGG CCGGAATCGT CACCGATGGC GACCTGCGTC GTCACATGTC GGGCCTGCTC GACAAGACCG CCGCCCAGGT
GATGACCGCC AACCCGACCA CCATCGCCCC CGACTCGCTG GCCGAGGAAG CGGTGGCTAT CATGAACGCG CGCAAGATCA
CCTCGCTTTT CGTGGTCGAT CCGGCGGAAC CGGGCGTGGC GCGCGGGCTG CTGCATATCC ACGACTGTCT GCGCGTCGGA
CTGGGCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7