Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0163
Type: CDS
Description: identified by match to protein family HMM PF00072; match to protein family HMM PF00512; match to protein family HMM PF00989; match to protein family HMM PF02518; match to protein family HMM TIGR00229
Source: Genbank
Position: CP000031.2:180023..182494 (+ strand)
Length: 2472
Dbxref: NCBI_GP:AAV93489.1
IMG: SPO0163: PAS/PAC sensor hybrid histidine kinase (EC 2.7.13.3)
Note: identified by match to protein family HMM PF00072; match to protein family HMM PF00512; match to protein family HMM PF00989; match to protein family HMM PF02518; match to protein family HMM TIGR00229
RefSeq: SPO_RS00835: PAS domain-containing hybrid sensor histidine kinase/response regulator
gbkey: CDS
gene: SPO0163
load_id: cds-AAV93489.1
locus_tag: SPO0163
parent_id: gene-SPO0163
product: sensory box histidine kinase/response regulator
protein_id: AAV93489.1
transl_table: 11
translation: MKTGFWIALVLVLIGYSALLGREAMVRLDTLSTAASDDIRWNMSQLEVELLRLQSAALKA RDGGQGDIQQLRTRFDIFYSRTQIVLRGALYDQAREIPEVQERLQSLRAFLAESVPIIDA PEPILADRLPELAHLVEQVSPEVRDLALTIVNTSARAADTQRLKVSETLRRLALSVLGLL VALTIVALLLLRLYRSSQVVSAEKEAVKSRFEAAVKSALDAVLVVDTEGHIIEFNGGAEA MFGYSRSEALGQPMSDLIIPPHYRARHEEGMRRFREHGTSRVVGRGHLRLEGMRKSGEVF PIELSISLAETSDQLVFISFLRDITNRLKTEDDLREARDTAQAGAQAKAQLLTVMSHEMR TPLNGILGSLDLMERDELSPKQVRLVRAIRVSGELLLTQVNRVLDLSRLESGMIEFPKEP FALLPMVRRLTESLTAAAEERGNRLQTTLVGDDPGVVLGNRIALQQALVNLLGNAIKFTR NGEISLEVERLNDDRMIEFRISDTGLGIPAKDIERIFDEFVTIDTAYARENPGTGLGLSI TRRLVWAMGGEIEVESIEHEGSLFLIRLPLEPGEAVELASEKERGQPEPGPLKGKRVLVI EDNDINRMLLLDMLEEFGCQVVLARDGFEGVAAAKSARYDLLLVDISMPGKDGLETLREI RAQEGPNGPVRAIAITANVRDEDKERFAAAGFDGFLAKPISMLQLQEMLSGLLLRPEAEA ERSTAREFIRRFGMAEYQRHLLGMVDALHAVCDDLANTELSETLKARVHEQAGSAAILGR ADLHSLLQEIEATDAADWPARRGGMLDRLKTELARTRAVSLGG
>SPO0163 class=Sequence position=CP000031.2:180023..182494 (+ strand)
TTGAAGACCG GTTTCTGGAT TGCACTCGTG CTGGTGCTGA TCGGGTATTC GGCGCTGCTC GGTCGCGAGG CGATGGTGCG
GCTCGACACC CTGTCGACAG CGGCGTCGGA CGATATCCGC TGGAACATGT CGCAGCTCGA AGTCGAACTG CTGCGACTTC
AGAGCGCGGC GCTCAAGGCG CGCGACGGAG GGCAGGGCGA TATCCAGCAG TTGCGAACCC GGTTCGACAT TTTCTACAGC
CGCACCCAGA TCGTGCTGCG CGGGGCGCTT TATGATCAGG CGCGCGAGAT TCCCGAAGTG CAGGAGCGGC TGCAGTCGCT
GCGGGCGTTC CTGGCCGAAA GCGTGCCGAT CATCGATGCG CCTGAACCGA TACTTGCCGA CCGTCTGCCC GAGTTGGCGC
ACCTGGTCGA ACAGGTGTCG CCCGAGGTGC GGGACCTGGC GCTGACGATC GTCAATACCT CGGCCCGTGC CGCTGATACC
CAGCGGCTGA AAGTGTCCGA GACCCTCCGG CGGCTGGCGT TGTCGGTGCT GGGATTGCTG GTGGCGCTGA CAATCGTTGC
GCTGCTCTTG CTGCGGCTCT ACCGCAGCAG TCAGGTGGTC TCGGCGGAAA AGGAGGCGGT GAAATCGCGG TTCGAGGCTG
CAGTGAAATC TGCGCTGGAT GCGGTGCTGG TGGTGGATAC CGAGGGCCAT ATCATCGAAT TCAACGGCGG TGCCGAGGCC
ATGTTCGGCT ATTCCCGCAG CGAGGCGCTG GGCCAGCCGA TGTCCGACCT GATCATCCCG CCCCATTACC GCGCCCGCCA
CGAAGAGGGG ATGCGACGGT TTCGCGAACA TGGCACCAGC CGGGTGGTCG GCAGGGGCCA CCTGCGTCTG GAGGGGATGC
GGAAATCGGG CGAGGTGTTT CCGATCGAAC TGTCAATCTC GCTGGCCGAG ACCAGCGACC AGCTGGTGTT CATCTCGTTC
CTGCGGGACA TCACCAACCG GCTGAAGACC GAAGACGATC TGCGCGAGGC GCGCGATACC GCACAGGCGG GCGCCCAGGC
CAAGGCGCAG TTGTTGACAG TGATGAGCCA CGAAATGCGA ACGCCGCTGA ACGGCATTCT CGGCTCGCTG GACCTGATGG
AACGTGACGA GCTGTCGCCA AAGCAGGTGC GCCTGGTGCG GGCGATCCGG GTCTCGGGCG AGCTGTTGCT GACCCAGGTC
AACCGGGTTC TCGACCTGTC GCGGCTGGAA TCCGGAATGA TCGAGTTCCC GAAAGAACCC TTTGCGCTGT TGCCGATGGT
CCGGCGCCTG ACCGAGAGCC TGACCGCTGC CGCCGAAGAG CGGGGCAACC GGCTGCAAAC CACTCTGGTC GGTGACGATC
CGGGAGTTGT GTTGGGCAAC CGGATCGCCT TGCAACAGGC CCTGGTGAAT CTGCTGGGAA ACGCGATCAA GTTCACCCGC
AACGGCGAGA TTTCACTGGA AGTGGAGAGG TTGAACGATG ACCGGATGAT CGAGTTCCGC ATATCGGATA CCGGTCTGGG
CATTCCCGCC AAGGATATCG AGCGGATTTT CGACGAATTC GTCACCATCG ACACCGCCTA TGCCCGCGAA AACCCGGGCA
CCGGGTTGGG GCTCAGCATC ACCCGGCGGC TGGTCTGGGC CATGGGCGGC GAGATCGAGG TCGAAAGTAT CGAGCATGAG
GGCAGCCTGT TCCTGATCCG CTTGCCGCTG GAGCCGGGAG AAGCGGTTGA ACTCGCCAGC GAGAAAGAAC GGGGCCAGCC
GGAACCCGGA CCACTGAAGG GCAAGCGGGT GCTGGTGATC GAGGATAACG ACATCAACCG GATGCTGCTT CTGGACATGC
TGGAGGAGTT CGGCTGTCAG GTCGTGTTGG CCCGCGACGG GTTCGAGGGC GTTGCCGCCG CCAAAAGTGC CCGGTACGAT
CTGTTGCTGG TCGATATCAG TATGCCGGGC AAGGACGGGC TGGAGACCTT GCGAGAAATC CGGGCACAAG AGGGCCCCAA
TGGCCCCGTG CGCGCCATCG CGATCACCGC CAATGTGCGC GACGAGGACA AGGAGAGGTT CGCCGCCGCC GGGTTCGACG
GATTTCTGGC CAAGCCGATC TCGATGCTCC AGCTGCAAGA GATGTTGAGC GGCCTGCTCC TGCGGCCCGA GGCCGAGGCA
GAGCGCTCGA CCGCGCGGGA GTTCATCCGC CGGTTCGGAA TGGCAGAGTA TCAGCGTCAC CTTTTGGGCA TGGTCGATGC
GCTGCATGCG GTTTGCGATG ATCTCGCCAA CACGGAGCTG AGTGAGACGC TCAAGGCGCG GGTGCATGAA CAGGCCGGGT
CGGCGGCGAT TCTGGGTCGT GCTGATCTGC ATTCATTGCT GCAAGAGATC GAGGCGACGG ATGCCGCTGA CTGGCCCGCC
CGCCGGGGTG GAATGCTGGA TCGGCTCAAA ACCGAATTGG CGCGGACACG GGCTGTGTCC TTGGGCGGTT AG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7