Roseobase: Ruegeria pomeroyi DSS-3

Name: maeB
Type: gene
Description:
Source: GenBank
Position: DSS3:11598..13853 (+ strand)
Length: 2256
Dbxref: GeneID:3194690
load_id: SPO0012
locus_tag: SPO0012
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:11598..13853 (+ strand)
Length: 2256
load_id: SPO0012.t01
parent_id: SPO0012
Parts:
Type: CDS
Description: identified by similarity to SP:O30808; match to protein family HMM PF00390; match to protein family HMM PF01515; match to protein family HMM PF03949; NCBI:malic enzyme; IMG:malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+)
Source: GenBank
Position: DSS3:11598..13853 (+ strand)
Length: 2256
Dbxref: GI:56694940
  GeneID:3194690
Note: identified by similarity to SP:O30808; match to protein family HMM PF00390; match to protein family HMM PF01515; match to protein family HMM PF03949
  NCBI:malic enzyme
  IMG:malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+)
codon_start: 1
eC_number: 1.1.1.40
load_id: SPO0012.p01
locus_tag: SPO0012
parent_id: SPO0012.t01
product: NADP-dependent malic enzyme
protein_id: REF_tigr:SPO0012
  YP_165285.1
transl_table: 11
translation: MPKAKITNEEALAFHLEPTPGKWEVQATVPMTTQRDLSLAYSPGVAVPCEAIAADPGLAY DYTNKGNLVAVISNGTAVLGLGNLGALGGKPVMEGKAVLFKRFADVNSIDIELDTEDPDE FCRAVRLMGPTFGGINLEDIKAPECFIIEQRLKEEMDIPVFHDDQHGTAVICAAGLINAL HISGKKIEDVKIVLNGAGAAGIACIELLKTMGARHENCIVCDTKGVIFQGRTEGMNQWKS AHAIKTELRSLEEAMKGADVFLGVSVKGAVTQEMVQSMADNPVIFAMANPDPEITPEEAH EVRPDAIVATGRSDYPNQVNNVLGFPYLFRGALDIHARAINDEMKIACAHALAALAREDV PDEVAMAYGKSLAFGRDYIIPTPFDPRLIHRIPPAVARAGMDTGAARRPIIDMDAYELGL KSRMDPTASILRGINARARKAQSRMIFAEGDDPRVLRAAVTYQRSGYGKALVVGRHDDVK AKLEAAGLGDAVRELEVVNAANTTHLETYKEFLYSRLQRKGFDNKDVHRLAARDRHVFSA LMLAHGHGDGLVTGATRKSAHVLHQISHVFDADAAHGAAGITALLHKGKIVLIGDTLVHE WPDEHDLATIAERAADVARHMGLEPRVAFVSFSTFGYPISERTEKLTKAPKVLEARGVSF EFEGEMTVDVALNPRSKEAYPFSRLTGPANILIVPARHSASISTKLMQEMAGATVIGPIL TGVDKPIQICSTVSTANDILNMAVLASAEIG
Type: exon
Description:
Source: GenBank
Position: DSS3:11598..13853 (+ strand)
Length: 2256
parent_id: SPO0012.t01
> class=Sequence position=DSS3:11598..13853 (+ strand)
ATGCCCAAAG CGAAGATCAC CAACGAAGAG GCGCTGGCCT TTCACCTGGA ACCGACCCCC GGCAAGTGGG AGGTGCAGGC
CACCGTTCCG ATGACCACGC AGCGCGATCT GTCGCTGGCC TATTCCCCCG GCGTGGCAGT ACCGTGCGAG GCGATCGCGG
CCGATCCGGG GCTGGCCTAT GACTATACCA ACAAGGGCAA CCTGGTTGCG GTGATCTCGA ACGGGACGGC GGTTCTGGGT
CTGGGCAATC TGGGTGCGCT GGGCGGCAAG CCGGTGATGG AGGGCAAGGC GGTGCTGTTC AAACGCTTTG CCGATGTGAA
CTCGATCGAC ATCGAGCTGG ATACCGAGGA CCCGGACGAG TTCTGCCGCG CGGTGCGGCT GATGGGGCCG ACATTCGGCG
GCATCAACCT GGAAGACATC AAGGCGCCCG AGTGTTTCAT CATCGAGCAG CGTCTGAAGG AAGAGATGGA TATCCCCGTC
TTTCACGACG ACCAGCACGG CACGGCGGTG ATCTGTGCGG CGGGGCTGAT CAACGCGCTG CACATCTCGG GCAAGAAGAT
CGAAGATGTG AAGATCGTGC TGAACGGCGC CGGCGCGGCG GGCATCGCCT GTATCGAACT GCTGAAAACC ATGGGCGCGC
GGCATGAAAA CTGCATTGTC TGCGATACCA AGGGTGTGAT CTTTCAGGGT CGCACCGAGG GCATGAACCA GTGGAAATCG
GCCCATGCCA TCAAGACCGA GCTGCGCAGC CTTGAAGAGG CGATGAAAGG GGCCGACGTG TTCCTGGGCG TCAGCGTCAA
GGGTGCGGTG ACGCAGGAAA TGGTGCAGAG CATGGCCGAC AATCCGGTCA TCTTTGCCAT GGCGAACCCC GATCCGGAAA
TCACACCCGA AGAGGCGCAT GAGGTGCGTC CCGATGCCAT CGTTGCCACC GGGCGCAGCG ACTATCCCAA CCAGGTCAAC
AACGTGTTGG GCTTTCCCTA TCTGTTCCGC GGCGCGCTGG ATATTCACGC CCGCGCCATC AACGACGAGA TGAAGATCGC
CTGCGCCCAT GCGCTGGCGG CGCTGGCCCG CGAGGATGTG CCCGACGAGG TTGCGATGGC CTATGGCAAG AGCCTGGCTT
TTGGACGCGA CTACATCATC CCGACCCCGT TCGACCCGCG CCTGATCCAC CGCATTCCGC CCGCCGTCGC GCGCGCGGGC
ATGGATACCG GCGCCGCGCG GCGGCCGATC ATCGACATGG ATGCCTATGA GCTGGGCCTG AAATCGCGGA TGGACCCGAC
CGCCAGCATC CTGCGCGGCA TCAACGCCCG CGCGCGCAAG GCGCAAAGCC GGATGATCTT TGCCGAGGGC GACGATCCCC
GCGTGCTGCG CGCGGCGGTC ACCTATCAGC GCTCGGGCTA TGGCAAGGCG CTGGTGGTGG GTCGTCATGA CGACGTGAAG
GCCAAGCTTG AAGCCGCCGG CCTGGGCGAC GCGGTGCGCG AGCTTGAGGT GGTGAACGCC GCCAACACCA CGCATCTGGA
GACCTATAAG GAGTTCCTGT ACTCGCGCCT GCAACGCAAG GGCTTCGATA ACAAGGACGT ACACCGGCTG GCCGCGCGCG
ACCGGCATGT GTTCTCGGCC CTGATGCTGG CGCATGGCCA CGGCGACGGG CTGGTGACCG GCGCGACCCG GAAATCGGCG
CATGTGCTGC ACCAGATCAG CCATGTGTTC GACGCCGATG CGGCGCATGG GGCGGCGGGG ATCACCGCAT TGTTGCACAA
GGGCAAGATC GTGCTGATCG GCGACACGCT GGTGCATGAA TGGCCCGACG AACACGATCT GGCCACCATC GCCGAACGCG
CCGCTGACGT GGCCCGCCAT ATGGGTCTGG AGCCGCGCGT GGCCTTTGTC AGCTTCTCGA CCTTTGGTTA TCCGATCTCG
GAGCGGACCG AAAAGCTGAC GAAGGCGCCC AAGGTACTGG AAGCGCGCGG CGTGAGTTTC GAGTTCGAAG GCGAGATGAC
TGTCGATGTG GCGCTGAACC CGCGCTCGAA AGAGGCCTAT CCCTTCTCGC GCCTCACCGG CCCCGCGAAC ATCCTGATCG
TGCCCGCGCG GCATTCGGCG TCGATCTCGA CCAAGCTGAT GCAGGAGATG GCGGGTGCCA CGGTGATCGG CCCGATCCTG
ACCGGTGTCG ACAAGCCGAT CCAGATCTGT TCGACCGTCT CCACCGCCAA TGACATCCTG AACATGGCGG TGCTGGCCTC
GGCCGAGATC GGCTAG
>maeB class=Sequence position=DSS3:11598..13853 (+ strand)
ATGCCCAAAG CGAAGATCAC CAACGAAGAG GCGCTGGCCT TTCACCTGGA ACCGACCCCC GGCAAGTGGG AGGTGCAGGC
CACCGTTCCG ATGACCACGC AGCGCGATCT GTCGCTGGCC TATTCCCCCG GCGTGGCAGT ACCGTGCGAG GCGATCGCGG
CCGATCCGGG GCTGGCCTAT GACTATACCA ACAAGGGCAA CCTGGTTGCG GTGATCTCGA ACGGGACGGC GGTTCTGGGT
CTGGGCAATC TGGGTGCGCT GGGCGGCAAG CCGGTGATGG AGGGCAAGGC GGTGCTGTTC AAACGCTTTG CCGATGTGAA
CTCGATCGAC ATCGAGCTGG ATACCGAGGA CCCGGACGAG TTCTGCCGCG CGGTGCGGCT GATGGGGCCG ACATTCGGCG
GCATCAACCT GGAAGACATC AAGGCGCCCG AGTGTTTCAT CATCGAGCAG CGTCTGAAGG AAGAGATGGA TATCCCCGTC
TTTCACGACG ACCAGCACGG CACGGCGGTG ATCTGTGCGG CGGGGCTGAT CAACGCGCTG CACATCTCGG GCAAGAAGAT
CGAAGATGTG AAGATCGTGC TGAACGGCGC CGGCGCGGCG GGCATCGCCT GTATCGAACT GCTGAAAACC ATGGGCGCGC
GGCATGAAAA CTGCATTGTC TGCGATACCA AGGGTGTGAT CTTTCAGGGT CGCACCGAGG GCATGAACCA GTGGAAATCG
GCCCATGCCA TCAAGACCGA GCTGCGCAGC CTTGAAGAGG CGATGAAAGG GGCCGACGTG TTCCTGGGCG TCAGCGTCAA
GGGTGCGGTG ACGCAGGAAA TGGTGCAGAG CATGGCCGAC AATCCGGTCA TCTTTGCCAT GGCGAACCCC GATCCGGAAA
TCACACCCGA AGAGGCGCAT GAGGTGCGTC CCGATGCCAT CGTTGCCACC GGGCGCAGCG ACTATCCCAA CCAGGTCAAC
AACGTGTTGG GCTTTCCCTA TCTGTTCCGC GGCGCGCTGG ATATTCACGC CCGCGCCATC AACGACGAGA TGAAGATCGC
CTGCGCCCAT GCGCTGGCGG CGCTGGCCCG CGAGGATGTG CCCGACGAGG TTGCGATGGC CTATGGCAAG AGCCTGGCTT
TTGGACGCGA CTACATCATC CCGACCCCGT TCGACCCGCG CCTGATCCAC CGCATTCCGC CCGCCGTCGC GCGCGCGGGC
ATGGATACCG GCGCCGCGCG GCGGCCGATC ATCGACATGG ATGCCTATGA GCTGGGCCTG AAATCGCGGA TGGACCCGAC
CGCCAGCATC CTGCGCGGCA TCAACGCCCG CGCGCGCAAG GCGCAAAGCC GGATGATCTT TGCCGAGGGC GACGATCCCC
GCGTGCTGCG CGCGGCGGTC ACCTATCAGC GCTCGGGCTA TGGCAAGGCG CTGGTGGTGG GTCGTCATGA CGACGTGAAG
GCCAAGCTTG AAGCCGCCGG CCTGGGCGAC GCGGTGCGCG AGCTTGAGGT GGTGAACGCC GCCAACACCA CGCATCTGGA
GACCTATAAG GAGTTCCTGT ACTCGCGCCT GCAACGCAAG GGCTTCGATA ACAAGGACGT ACACCGGCTG GCCGCGCGCG
ACCGGCATGT GTTCTCGGCC CTGATGCTGG CGCATGGCCA CGGCGACGGG CTGGTGACCG GCGCGACCCG GAAATCGGCG
CATGTGCTGC ACCAGATCAG CCATGTGTTC GACGCCGATG CGGCGCATGG GGCGGCGGGG ATCACCGCAT TGTTGCACAA
GGGCAAGATC GTGCTGATCG GCGACACGCT GGTGCATGAA TGGCCCGACG AACACGATCT GGCCACCATC GCCGAACGCG
CCGCTGACGT GGCCCGCCAT ATGGGTCTGG AGCCGCGCGT GGCCTTTGTC AGCTTCTCGA CCTTTGGTTA TCCGATCTCG
GAGCGGACCG AAAAGCTGAC GAAGGCGCCC AAGGTACTGG AAGCGCGCGG CGTGAGTTTC GAGTTCGAAG GCGAGATGAC
TGTCGATGTG GCGCTGAACC CGCGCTCGAA AGAGGCCTAT CCCTTCTCGC GCCTCACCGG CCCCGCGAAC ATCCTGATCG
TGCCCGCGCG GCATTCGGCG TCGATCTCGA CCAAGCTGAT GCAGGAGATG GCGGGTGCCA CGGTGATCGG CCCGATCCTG
ACCGGTGTCG ACAAGCCGAT CCAGATCTGT TCGACCGTCT CCACCGCCAA TGACATCCTG AACATGGCGG TGCTGGCCTC
GGCCGAGATC GGCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7