Roseobase: Ruegeria pomeroyi DSS-3

Name: mepA
Type: gene
Description:
Source: Genbank
Position: CP000031.2:131966..132847 (+ strand)
Length: 882
gbkey: Gene
gene: mepA
gene_biotype: protein_coding
load_id: gene-SPO0124
locus_tag: SPO0124
Parts:
Type: CDS
Description: identified by similarity to SP:P14007
Source: Genbank
Position: CP000031.2:131966..132847 (+ strand)
Length: 882
Dbxref: NCBI_GP:AAV93452.1
IMG: mepA: murein endopeptidase. Metallo peptidase. MEROPS family M74
Note: identified by similarity to SP:P14007
RefSeq: SPO_RS00635: mepA: penicillin-insensitive murein endopeptidase
gbkey: CDS
gene: mepA
load_id: cds-AAV93452.1
locus_tag: SPO0124
parent_id: gene-SPO0124
product: murein endopeptidase
protein_id: AAV93452.1
transl_table: 11
translation: MFFQVIAVFLLALIPVLGAVPAQAEPLAKELFGAQKSASRQKPAAYGSYAKGCAAGLEQL PETGPTWQAMRLSRNRNWGHPETIDFIRDLSGFAARQKGWSGLYIGDISQPRGGPMLTGH RSHQLGLDIDIWMLQANNLRLSGQHRENISSISLRRAKGAYVNDNWTRQHHAIMREAARD KRVARIFVFPGAKVWMCNNEKGDRSYLRKIRPWWGHHYHFHVRLSCPRGSRGCVDQTPPP QGDGCAEAQEWVNNILNPPPPKPRDPNAPPPKKRREYVLADLPKQCASVLRSQ
>mepA class=Sequence position=CP000031.2:131966..132847 (+ strand)
GTGTTTTTTC AAGTCATTGC CGTTTTTCTG CTGGCGCTGA TTCCGGTACT GGGCGCGGTA CCTGCCCAAG CCGAACCGCT
GGCAAAGGAG CTGTTTGGCG CGCAGAAAAG CGCCTCTCGG CAGAAACCCG CCGCTTATGG CAGCTATGCC AAGGGCTGCG
CCGCCGGGCT CGAGCAACTG CCCGAAACCG GCCCCACCTG GCAGGCGATG CGCCTGAGCC GCAACCGCAA CTGGGGCCAC
CCCGAGACCA TCGACTTTAT CCGTGATCTG AGCGGCTTTG CCGCCCGGCA GAAAGGCTGG AGCGGGCTCT ATATCGGCGA
TATCAGCCAG CCGCGTGGCG GGCCGATGCT GACCGGGCAT CGCAGCCACC AACTGGGGCT GGATATCGAC ATCTGGATGC
TGCAGGCCAA CAACCTGCGT TTGTCGGGTC AGCATCGCGA AAACATCTCG TCGATTTCGC TGCGCCGGGC CAAGGGGGCC
TATGTCAACG ACAACTGGAC CCGCCAGCAT CATGCGATCA TGCGCGAGGC GGCGCGCGAC AAGCGGGTGG CGCGCATCTT
TGTCTTTCCC GGTGCCAAGG TCTGGATGTG CAACAACGAA AAGGGCGACC GCTCCTATTT GCGCAAGATC CGGCCCTGGT
GGGGACATCA TTACCATTTC CATGTGCGGC TGAGCTGTCC GCGTGGCTCG CGCGGCTGCG TCGATCAGAC CCCGCCGCCG
CAGGGGGATG GCTGTGCCGA GGCGCAGGAA TGGGTCAACA ACATCCTGAA CCCGCCGCCC CCGAAGCCGC GTGACCCCAA
CGCGCCGCCA CCCAAGAAAC GCCGCGAATA CGTGCTGGCC GACCTGCCGA AGCAATGCGC CTCCGTCTTG CGCTCGCAAT
AG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7