Roseobase: Ruegeria pomeroyi DSS-3

Name: msrA-1
Type: CDS
Description: identified by similarity to SP:Q93P63; match to protein family HMM PF01625; match to protein family HMM TIGR00401
Source: Genbank
Position: CP000031.2:14726..15388 (- strand)
Length: 663
Dbxref: NCBI_GP:AAV93345.1
IMG: msrA-1: methionine-S-sulfoxide reductase
Note: identified by similarity to SP:Q93P63; match to protein family HMM PF01625; match to protein family HMM TIGR00401
RefSeq: SPO_RS00070: msrA: peptide-methionine (S)-S-oxide reductase MsrA
gbkey: CDS
gene: msrA-1
load_id: cds-AAV93345.1
locus_tag: SPO0014
parent_id: gene-SPO0014
product: methionine-S-sulfoxide reductase
protein_id: AAV93345.1
transl_table: 11
translation: MFPIQTLKPIALIAAMALATILQGGKAEAAETQTLTVAGGCFWCVEADFEKVPGVLGAVS GYTGGTLDNPTYKQVTRGGTGHFEAVQILFDPDQVSRERLLHMFFRSVDPTDAGGQFCDR GDSYRTAIFVSNKVESALASQAKANAEAELGQTVVTPILTAGRFYPAEAYHQDYAKGEKL VLTRFGPKRQQEAYKLYRKSCGRDARVKQLWGDAAPFAGS
>msrA-1 class=Sequence position=CP000031.2:14726..15388 (- strand)
ATGTTCCCGA TCCAGACACT CAAACCCATT GCCCTGATCG CCGCCATGGC CCTGGCCACC ATCCTGCAAG GGGGCAAGGC
AGAGGCCGCA GAGACCCAGA CCCTGACCGT TGCGGGTGGC TGTTTCTGGT GTGTCGAGGC CGATTTCGAG AAAGTGCCCG
GCGTGCTGGG CGCGGTGTCC GGTTATACTG GCGGGACACT CGACAACCCG ACCTACAAGC AGGTCACGCG CGGCGGCACC
GGGCATTTTG AGGCGGTGCA GATCCTGTTC GACCCGGATC AGGTTTCACG CGAACGCCTG CTGCATATGT TTTTCCGCTC
GGTCGACCCA ACCGATGCAG GCGGCCAGTT CTGTGATCGC GGTGACAGCT ATCGCACCGC GATATTCGTC TCTAACAAGG
TGGAAAGTGC GTTGGCATCT CAGGCCAAAG CCAACGCAGA AGCGGAACTG GGCCAAACTG TCGTGACCCC GATCCTGACG
GCGGGCCGGT TTTATCCGGC CGAGGCCTAT CATCAGGACT ATGCCAAGGG AGAAAAGCTG GTGCTGACCC GGTTCGGCCC
GAAACGGCAG CAAGAGGCCT ACAAGCTCTA TCGCAAATCC TGTGGCCGCG ATGCGCGGGT GAAACAGCTT TGGGGGGATG
CGGCGCCCTT TGCGGGCAGC TAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7