Roseobase: Ruegeria pomeroyi DSS-3

Name: msrA-1
Type: gene
Description:
Source: GenBank
Position: DSS3:14726..15388 (- strand)
Length: 663
Dbxref: GeneID:3196173
load_id: SPO0014
locus_tag: SPO0014
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:14726..15388 (- strand)
Length: 663
load_id: SPO0014.t01
parent_id: SPO0014
Parts:
Type: CDS
Description: identified by similarity to SP:Q93P63; match to protein family HMM PF01625; match to protein family HMM TIGR00401; NCBI:peptide-methionine (S)-S-oxide reductase; IMG:peptide-methionine (S)-S-oxide reductase
Source: GenBank
Position: DSS3:14726..15388 (- strand)
Length: 663
Dbxref: GI:56694942
  GeneID:3196173
Note: identified by similarity to SP:Q93P63; match to protein family HMM PF01625; match to protein family HMM TIGR00401
  NCBI:peptide-methionine (S)-S-oxide reductase
  IMG:peptide-methionine (S)-S-oxide reductase
codon_start: 1
eC_number: 1.8.4.-
load_id: SPO0014.p01
locus_tag: SPO0014
parent_id: SPO0014.t01
product: methionine-S-sulfoxide reductase
protein_id: REF_tigr:SPO0014
  YP_165287.1
transl_table: 11
translation: MFPIQTLKPIALIAAMALATILQGGKAEAAETQTLTVAGGCFWCVEADFEKVPGVLGAVS GYTGGTLDNPTYKQVTRGGTGHFEAVQILFDPDQVSRERLLHMFFRSVDPTDAGGQFCDR GDSYRTAIFVSNKVESALASQAKANAEAELGQTVVTPILTAGRFYPAEAYHQDYAKGEKL VLTRFGPKRQQEAYKLYRKSCGRDARVKQLWGDAAPFAGS
Type: exon
Description:
Source: GenBank
Position: DSS3:14726..15388 (- strand)
Length: 663
parent_id: SPO0014.t01
> class=Sequence position=DSS3:14726..15388 (- strand)
ATGTTCCCGA TCCAGACACT CAAACCCATT GCCCTGATCG CCGCCATGGC CCTGGCCACC ATCCTGCAAG GGGGCAAGGC
AGAGGCCGCA GAGACCCAGA CCCTGACCGT TGCGGGTGGC TGTTTCTGGT GTGTCGAGGC CGATTTCGAG AAAGTGCCCG
GCGTGCTGGG CGCGGTGTCC GGTTATACTG GCGGGACACT CGACAACCCG ACCTACAAGC AGGTCACGCG CGGCGGCACC
GGGCATTTTG AGGCGGTGCA GATCCTGTTC GACCCGGATC AGGTTTCACG CGAACGCCTG CTGCATATGT TTTTCCGCTC
GGTCGACCCA ACCGATGCAG GCGGCCAGTT CTGTGATCGC GGTGACAGCT ATCGCACCGC GATATTCGTC TCTAACAAGG
TGGAAAGTGC GTTGGCATCT CAGGCCAAAG CCAACGCAGA AGCGGAACTG GGCCAAACTG TCGTGACCCC GATCCTGACG
GCGGGCCGGT TTTATCCGGC CGAGGCCTAT CATCAGGACT ATGCCAAGGG AGAAAAGCTG GTGCTGACCC GGTTCGGCCC
GAAACGGCAG CAAGAGGCCT ACAAGCTCTA TCGCAAATCC TGTGGCCGCG ATGCGCGGGT GAAACAGCTT TGGGGGGATG
CGGCGCCCTT TGCGGGCAGC TAG
>msrA-1 class=Sequence position=DSS3:14726..15388 (- strand)
ATGTTCCCGA TCCAGACACT CAAACCCATT GCCCTGATCG CCGCCATGGC CCTGGCCACC ATCCTGCAAG GGGGCAAGGC
AGAGGCCGCA GAGACCCAGA CCCTGACCGT TGCGGGTGGC TGTTTCTGGT GTGTCGAGGC CGATTTCGAG AAAGTGCCCG
GCGTGCTGGG CGCGGTGTCC GGTTATACTG GCGGGACACT CGACAACCCG ACCTACAAGC AGGTCACGCG CGGCGGCACC
GGGCATTTTG AGGCGGTGCA GATCCTGTTC GACCCGGATC AGGTTTCACG CGAACGCCTG CTGCATATGT TTTTCCGCTC
GGTCGACCCA ACCGATGCAG GCGGCCAGTT CTGTGATCGC GGTGACAGCT ATCGCACCGC GATATTCGTC TCTAACAAGG
TGGAAAGTGC GTTGGCATCT CAGGCCAAAG CCAACGCAGA AGCGGAACTG GGCCAAACTG TCGTGACCCC GATCCTGACG
GCGGGCCGGT TTTATCCGGC CGAGGCCTAT CATCAGGACT ATGCCAAGGG AGAAAAGCTG GTGCTGACCC GGTTCGGCCC
GAAACGGCAG CAAGAGGCCT ACAAGCTCTA TCGCAAATCC TGTGGCCGCG ATGCGCGGGT GAAACAGCTT TGGGGGGATG
CGGCGCCCTT TGCGGGCAGC TAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7