Roseobase: Ruegeria pomeroyi DSS-3

Name: mutS
Type: gene
Description:
Source: GenBank
Position: DSS3:8822..11455 (- strand)
Length: 2634
Dbxref: GeneID:3194479
load_id: SPO0011
locus_tag: SPO0011
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:8822..11455 (- strand)
Length: 2634
load_id: SPO0011.t01
parent_id: SPO0011
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00488; match to protein family HMM PF01624; match to protein family HMM PF05188; match to protein family HMM PF05190; match to protein family HMM PF05192; match to protein family HMM TIGR01070; NCBI:DNA mismatch repair protein MutS; IMG:DNA mismatch repair protein MutS
Source: GenBank
Position: DSS3:8822..11455 (- strand)
Length: 2634
Dbxref: GI:56694939
  GeneID:3194479
Note: identified by match to protein family HMM PF00488; match to protein family HMM PF01624; match to protein family HMM PF05188; match to protein family HMM PF05190; match to protein family HMM PF05192; match to protein family HMM TIGR01070
  NCBI:DNA mismatch repair protein MutS
  IMG:DNA mismatch repair protein MutS
codon_start: 1
load_id: SPO0011.p01
locus_tag: SPO0011
parent_id: SPO0011.t01
product: DNA mismatch repair protein MutS
protein_id: REF_tigr:SPO0011
  YP_165284.1
transl_table: 11
translation: MTTVTPMMAQYLEIKEAYADALLFYRMGDFYEMFFDDAVAAAEALDIALTKRGKHEGEDI PMCGVPVHAAEGYLLTLIRKGFRVAVCEQMESPAEAKKRGSKSVVRRDVVRLVTPGTLTE DALLEARRHNFLVAYAEVRSGAALAWADISTGDFHVMPVTRPRLSPELARLAPSELLVVD EPVFQQLRPLADDHRIPLTPLGKASFDSMAAEKRLCELYKVGSLEGFGTFARAELSAMGA LIDYLDITQKGKLPLLQPPVQEAEDRVMQIDAATRRNLELTRSLSGERGGSLLSVIDRTV TPGGARLLEQRLGSPSRNLDVIHARLSALDFCIDHSTLAADLRAALRKTPDLDRALSRLA LDRGGPRDLAAIRNGLGQAEAIAALCDGLELPGLIAGACADLNGFDELLGLLDTALVAEP PLLARDGGFIAPGYDSDLDEARELRDKGRGVIAGMQQKYAEHTGIASLKIKHNNVLGYFI ETTATHAAKMLNPPLSETYIHRQTTANQVRFTTVELSELETRILNAGNHALEIEKRLYSS LSGAVLEQAARLNIAARGLAELDLATALADLARAENWCRPSVDPSRAFAIEGGRHPVVEH ALRRQGGDPFVANDCDLSADKGAAIRLLTGPNMAGKSTYLRQNALITLLAQIGSYVPADS AHIGVVSQLFSRVGASDDLARGRSTFMVEMVETAAILNQADDHALVILDEIGRGTATYDG LSIAWATLEHLHATNRCRALFATHYHELTALAATLDGVENLTVAVKEWEGEVIFLHEVRK GAADRSYGVQVAQLAGLPPSVVARARVVLDQLEKSEREGGKQKALIDDLPLFSAAPPLPP PAPKTSPADAMLKEIHPDELTPRQALEMLYKLKEAAR
Type: exon
Description:
Source: GenBank
Position: DSS3:8822..11455 (- strand)
Length: 2634
parent_id: SPO0011.t01
> class=Sequence position=DSS3:8822..11455 (- strand)
TTGACCACCG TCACGCCCAT GATGGCACAA TATCTGGAAA TCAAAGAGGC TTATGCCGAT GCCCTGCTGT TCTATCGCAT
GGGCGATTTC TACGAGATGT TCTTTGACGA CGCGGTCGCC GCGGCCGAGG CGCTGGATAT CGCGCTGACC AAGCGCGGCA
AGCACGAGGG CGAGGATATT CCGATGTGCG GCGTCCCGGT CCACGCCGCC GAGGGCTATC TGCTGACCCT GATCCGTAAG
GGATTCCGGG TAGCGGTCTG CGAACAGATG GAAAGCCCGG CCGAGGCCAA GAAGCGTGGA TCGAAATCGG TGGTCCGGCG
CGATGTGGTG CGGCTGGTCA CCCCGGGCAC CCTGACCGAG GACGCGCTGC TTGAGGCGCG TCGCCACAAT TTTCTGGTGG
CTTATGCCGA GGTGCGCAGT GGCGCGGCGC TGGCCTGGGC CGATATCTCG ACCGGTGATT TCCACGTGAT GCCGGTGACC
CGCCCGCGCC TCAGCCCGGA ACTGGCGCGG CTGGCCCCGT CCGAGCTGCT GGTGGTCGAT GAACCGGTGT TCCAGCAGCT
GCGCCCGCTG GCTGACGATC ACCGCATTCC GCTGACCCCA CTGGGCAAGG CCAGTTTCGA CAGCATGGCC GCCGAAAAGC
GCCTGTGCGA GCTGTACAAG GTTGGCTCGC TGGAGGGGTT CGGTACGTTC GCGCGCGCCG AACTGTCGGC CATGGGTGCG
CTGATCGACT ATTTGGACAT CACGCAAAAG GGCAAACTGC CGCTGCTGCA ACCCCCGGTG CAAGAGGCTG AGGATCGGGT
GATGCAGATC GACGCCGCCA CGCGACGCAA TCTGGAGCTG ACCCGTTCCC TGTCAGGCGA GCGCGGCGGC TCGCTCTTGT
CGGTGATCGA CCGCACGGTC ACGCCGGGGG GCGCCCGCCT GCTGGAACAG CGCCTTGGCA GCCCGTCGCG CAACCTGGAT
GTAATCCACG CCCGGCTTTC GGCGCTGGAT TTCTGCATCG ACCATTCGAC CCTGGCCGCC GACCTACGTG CGGCCCTGCG
CAAGACGCCC GATCTGGACC GTGCCCTTTC GCGGCTGGCG CTGGACCGGG GCGGGCCGCG CGACCTTGCC GCGATCCGCA
ACGGGCTGGG TCAGGCCGAG GCGATTGCGG CCCTCTGCGA CGGGCTGGAA CTGCCCGGCT TGATCGCGGG TGCCTGCGCC
GATCTGAACG GGTTCGACGA GTTGCTTGGC CTGCTCGACA CCGCGTTGGT GGCCGAACCG CCGCTACTAG CCCGTGATGG
CGGCTTTATC GCGCCAGGCT ATGACAGCGA TTTGGACGAG GCGCGCGAGC TGCGCGACAA GGGCCGTGGC GTCATCGCCG
GGATGCAGCA GAAATATGCC GAACATACCG GCATCGCCTC GCTGAAGATC AAGCACAACA ACGTGCTGGG CTACTTCATC
GAAACCACCG CGACCCACGC GGCCAAGATG CTGAACCCGC CCCTGAGCGA GACCTATATC CACCGCCAGA CCACAGCCAA
TCAGGTGCGC TTTACTACGG TCGAACTGAG CGAGTTGGAA ACCCGTATCC TGAACGCCGG TAATCACGCG CTCGAGATCG
AAAAGCGGCT CTATTCAAGC CTTTCCGGGG CAGTTCTGGA GCAGGCCGCC CGCCTTAATA TCGCCGCACG CGGCCTGGCC
GAACTGGATC TGGCCACCGC GCTGGCCGAT CTGGCGCGCG CCGAAAACTG GTGCAGGCCC AGCGTCGATC CCTCGCGCGC
CTTTGCCATC GAAGGCGGCC GCCACCCGGT GGTGGAACAC GCGCTGCGCC GTCAGGGGGG GGATCCTTTT GTGGCCAATG
ACTGCGATCT CAGCGCCGAC AAGGGCGCCG CGATCCGCCT GCTGACCGGC CCCAACATGG CTGGTAAATC GACCTATCTG
CGGCAGAACG CGCTGATCAC CCTGCTGGCC CAGATCGGCA GTTACGTGCC CGCCGACAGC GCCCATATCG GGGTGGTCAG
CCAGTTGTTC AGCCGCGTCG GCGCCTCGGA CGATCTGGCG CGCGGCCGCT CGACCTTCAT GGTCGAGATG GTGGAAACCG
CCGCCATCCT GAACCAGGCC GACGACCATG CGCTGGTCAT CCTGGACGAG ATCGGGCGCG GCACCGCCAC CTATGACGGG
CTTTCCATCG CCTGGGCCAC GCTGGAACAT CTTCACGCGA CCAATCGCTG CCGCGCTCTG TTCGCCACCC ATTACCATGA
ATTGACCGCG CTCGCCGCGA CCCTCGACGG GGTCGAGAAC CTGACCGTCG CGGTCAAAGA GTGGGAGGGC GAGGTGATAT
TCCTGCACGA GGTGCGCAAA GGCGCCGCCG ACCGCTCTTA TGGTGTGCAG GTCGCCCAGC TTGCGGGCCT GCCGCCTTCG
GTTGTCGCGC GTGCCCGGGT GGTTCTGGAC CAGCTGGAGA AATCCGAACG CGAGGGCGGC AAGCAAAAGG CGCTGATCGA
CGATCTGCCG CTGTTCTCGG CCGCGCCGCC ACTGCCACCA CCCGCGCCCA AAACCTCACC CGCCGATGCG ATGCTCAAGG
AGATCCACCC CGACGAGCTG ACCCCCCGCC AGGCGCTGGA GATGCTTTAT AAACTGAAAG AGGCGGCCCG CTGA
>mutS class=Sequence position=DSS3:8822..11455 (- strand)
TTGACCACCG TCACGCCCAT GATGGCACAA TATCTGGAAA TCAAAGAGGC TTATGCCGAT GCCCTGCTGT TCTATCGCAT
GGGCGATTTC TACGAGATGT TCTTTGACGA CGCGGTCGCC GCGGCCGAGG CGCTGGATAT CGCGCTGACC AAGCGCGGCA
AGCACGAGGG CGAGGATATT CCGATGTGCG GCGTCCCGGT CCACGCCGCC GAGGGCTATC TGCTGACCCT GATCCGTAAG
GGATTCCGGG TAGCGGTCTG CGAACAGATG GAAAGCCCGG CCGAGGCCAA GAAGCGTGGA TCGAAATCGG TGGTCCGGCG
CGATGTGGTG CGGCTGGTCA CCCCGGGCAC CCTGACCGAG GACGCGCTGC TTGAGGCGCG TCGCCACAAT TTTCTGGTGG
CTTATGCCGA GGTGCGCAGT GGCGCGGCGC TGGCCTGGGC CGATATCTCG ACCGGTGATT TCCACGTGAT GCCGGTGACC
CGCCCGCGCC TCAGCCCGGA ACTGGCGCGG CTGGCCCCGT CCGAGCTGCT GGTGGTCGAT GAACCGGTGT TCCAGCAGCT
GCGCCCGCTG GCTGACGATC ACCGCATTCC GCTGACCCCA CTGGGCAAGG CCAGTTTCGA CAGCATGGCC GCCGAAAAGC
GCCTGTGCGA GCTGTACAAG GTTGGCTCGC TGGAGGGGTT CGGTACGTTC GCGCGCGCCG AACTGTCGGC CATGGGTGCG
CTGATCGACT ATTTGGACAT CACGCAAAAG GGCAAACTGC CGCTGCTGCA ACCCCCGGTG CAAGAGGCTG AGGATCGGGT
GATGCAGATC GACGCCGCCA CGCGACGCAA TCTGGAGCTG ACCCGTTCCC TGTCAGGCGA GCGCGGCGGC TCGCTCTTGT
CGGTGATCGA CCGCACGGTC ACGCCGGGGG GCGCCCGCCT GCTGGAACAG CGCCTTGGCA GCCCGTCGCG CAACCTGGAT
GTAATCCACG CCCGGCTTTC GGCGCTGGAT TTCTGCATCG ACCATTCGAC CCTGGCCGCC GACCTACGTG CGGCCCTGCG
CAAGACGCCC GATCTGGACC GTGCCCTTTC GCGGCTGGCG CTGGACCGGG GCGGGCCGCG CGACCTTGCC GCGATCCGCA
ACGGGCTGGG TCAGGCCGAG GCGATTGCGG CCCTCTGCGA CGGGCTGGAA CTGCCCGGCT TGATCGCGGG TGCCTGCGCC
GATCTGAACG GGTTCGACGA GTTGCTTGGC CTGCTCGACA CCGCGTTGGT GGCCGAACCG CCGCTACTAG CCCGTGATGG
CGGCTTTATC GCGCCAGGCT ATGACAGCGA TTTGGACGAG GCGCGCGAGC TGCGCGACAA GGGCCGTGGC GTCATCGCCG
GGATGCAGCA GAAATATGCC GAACATACCG GCATCGCCTC GCTGAAGATC AAGCACAACA ACGTGCTGGG CTACTTCATC
GAAACCACCG CGACCCACGC GGCCAAGATG CTGAACCCGC CCCTGAGCGA GACCTATATC CACCGCCAGA CCACAGCCAA
TCAGGTGCGC TTTACTACGG TCGAACTGAG CGAGTTGGAA ACCCGTATCC TGAACGCCGG TAATCACGCG CTCGAGATCG
AAAAGCGGCT CTATTCAAGC CTTTCCGGGG CAGTTCTGGA GCAGGCCGCC CGCCTTAATA TCGCCGCACG CGGCCTGGCC
GAACTGGATC TGGCCACCGC GCTGGCCGAT CTGGCGCGCG CCGAAAACTG GTGCAGGCCC AGCGTCGATC CCTCGCGCGC
CTTTGCCATC GAAGGCGGCC GCCACCCGGT GGTGGAACAC GCGCTGCGCC GTCAGGGGGG GGATCCTTTT GTGGCCAATG
ACTGCGATCT CAGCGCCGAC AAGGGCGCCG CGATCCGCCT GCTGACCGGC CCCAACATGG CTGGTAAATC GACCTATCTG
CGGCAGAACG CGCTGATCAC CCTGCTGGCC CAGATCGGCA GTTACGTGCC CGCCGACAGC GCCCATATCG GGGTGGTCAG
CCAGTTGTTC AGCCGCGTCG GCGCCTCGGA CGATCTGGCG CGCGGCCGCT CGACCTTCAT GGTCGAGATG GTGGAAACCG
CCGCCATCCT GAACCAGGCC GACGACCATG CGCTGGTCAT CCTGGACGAG ATCGGGCGCG GCACCGCCAC CTATGACGGG
CTTTCCATCG CCTGGGCCAC GCTGGAACAT CTTCACGCGA CCAATCGCTG CCGCGCTCTG TTCGCCACCC ATTACCATGA
ATTGACCGCG CTCGCCGCGA CCCTCGACGG GGTCGAGAAC CTGACCGTCG CGGTCAAAGA GTGGGAGGGC GAGGTGATAT
TCCTGCACGA GGTGCGCAAA GGCGCCGCCG ACCGCTCTTA TGGTGTGCAG GTCGCCCAGC TTGCGGGCCT GCCGCCTTCG
GTTGTCGCGC GTGCCCGGGT GGTTCTGGAC CAGCTGGAGA AATCCGAACG CGAGGGCGGC AAGCAAAAGG CGCTGATCGA
CGATCTGCCG CTGTTCTCGG CCGCGCCGCC ACTGCCACCA CCCGCGCCCA AAACCTCACC CGCCGATGCG ATGCTCAAGG
AGATCCACCC CGACGAGCTG ACCCCCCGCC AGGCGCTGGA GATGCTTTAT AAACTGAAAG AGGCGGCCCG CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7